TkA04G132890 | RubberDandelionOmics

Gene overview

TkA04G132890

Reference: TK1151 Chr: Chr04 Coordinates: 34580257-34581542 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA04G132890|TK1151|cDNA

ATGCACTTCTCCGAGCAGTGTGAAATTGGTGGAACAAGAATTTTGACAGAGGGAGGAGAAAGGGTTGATTGGCATTCCGCCTGTTCGAGATATTGCAGAGGGTTCCATAGTAACACAAGGGGTGTGGCTGCACGTGCATTACATCTATCAAGAGGAGTTGAGAAACCAAGTGGTAGAGTGACATATATAGTTCTTGAACAGAAACAAAAAACTGGAGGGAGGACTAAAGTTCTTCTGGAAACTGTCATTGTGCATAAACT...

CDS

Download CDS FASTA

429 bp · TkA04G132890|TK1151|CDS

ATGCACTTCTCCGAGCAGTGTGAAATTGGTGGAACAAGAATTTTGACAGAGGGAGGAGAAAGGGTTGATTGGCATTCCGCCTGTTCGAGATATTGCAGAGGGTTCCATAGTAACACAAGGGGTGTGGCTGCACGTGCATTACATCTATCAAGAGGAGTTGAGAAACCAAGTGGTAGAGTGACATATATAGTTCTTGAACAGAAACAAAAAACTGGAGGGAGGACTAAAGTTCTTCTGGAAACTGTCATTGTGCATAAACT...

Protein

Download Protein FASTA

142 aa · TkA04G132890|TK1151|PROTEIN

MHFSEQCEIGGTRILTEGGERVDWHSACSRYCRGFHSNTRGVAARALHLSRGVEKPSGRVTYIVLEQKQKTGGRTKVLLETVIVHKLADIFVASFEISFEEQLAMLDSVDVKVRLSKATELVDRHLQSIRVAENIFYVSRYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G132890`
TK1151 ID	TkA04G132890
OH-1004 ID	LXL04_035407
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G132890

Location Chr04:34580257-34581542 (-)

Description Similar to Lon protease homolog 2, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47040`	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix (By similarity).	Arabidopsis LON2 is necessary for peroxisomal function and sustained matrix protein import.2009 · DOI: 10.1104/pp.109.142505

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BDV1`	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix.	No verified direct reference in this release
`Os09g0533400`	ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0006625 protein targeting to peroxisome Biological Process

GO:0016485 protein processing Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016560 protein import into peroxisome matrix, docking Biological Process

GO:0048527 lateral root development Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005782 peroxisomal matrix Cellular Component

GO:0070013 intracellular organelle lumen Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G47040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.427

Rank 1 · TkA04G132890 · TK1151

Nucleus0.361

Rank 2 · TkA04G132890 · TK1151

Mitochondrion0.194

Rank 3 · TkA04G132890 · TK1151

Cell membrane0.072

Rank 4 · TkA04G132890 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA04G132890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02190LON_substr_bdg85-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G132890	`PF02190`	LON_substr_bdg	85	124	1.5e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64948`	Arabidopsis thaliana	sp\|O64948\|LONP2_ARATH Lon protease homolog 2, peroxisomal	57.000%	Swiss-Prot	Medium
`B8BDV1`	Oryza sativa subsp. indica	sp\|B8BDV1\|LONP2_ORYSI Lon protease homolog 2, peroxisomal	52.200%	Swiss-Prot	High
`Q0J032`	Oryza sativa subsp. japonica	sp\|Q0J032\|LONP2_ORYSJ Lon protease homolog 2, peroxisomal	51.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card