TkA04G130950 | RubberDandelionOmics

Gene overview

TkA04G130950

Reference: TK1151 Chr: Chr04 Coordinates: 34140890-34144295 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2006 bp · TkA04G130950|TK1151|cDNA

GTCTTAAATGCAATTACATTTAAACCCAATTAGTTTGCCATACGCTTGAGAAGCCTTCTGTTCAGTCATCGCACACAGTGAGGAGTCACCGGCAATGGCAGCCATCGGTGGAGGAAACAGTTCCTCAAATTCAAACGCCTCATCAACCCCTGCCTCTCATCAAGCCCCCAAAATCCTATTAGCCAAGCCAGCTTTAGTCACTGCCGCCAAGTACAACCGCGGGCCTGGTGGCGGTGGAGGCGGCGGTGGCCCTGATGACG...

CDS

Download CDS FASTA

1227 bp · TkA04G130950|TK1151|CDS

ATGGCAGCCATCGGTGGAGGAAACAGTTCCTCAAATTCAAACGCCTCATCAACCCCTGCCTCTCATCAAGCCCCCAAAATCCTATTAGCCAAGCCAGCTTTAGTCACTGCCGCCAAGTACAACCGCGGGCCTGGTGGCGGTGGAGGCGGCGGTGGCCCTGATGACGCTTCGTCCTCACTCCGCTCTCGCCTTCCCTCCGTTGGATTTCTCAATCTATTATCCGACTCCTGGGATTTCCACACCGATCGATTCCTTCCGTA...

Protein

Download Protein FASTA

408 aa · TkA04G130950|TK1151|PROTEIN

MAAIGGGNSSSNSNASSTPASHQAPKILLAKPALVTAAKYNRGPGGGGGGGGPDDASSSLRSRLPSVGFLNLLSDSWDFHTDRFLPYLTDNTDFTVIGVIGSPGVGKSTIMNEIYGFDATSPGTLPPFPIESMETKALAKHCTVGIEPRITSERIILLDTQPVYSPSVLADMIRPDGSSTISVLGGEPLPAELAHELMNIQLGVLLTSICHIILVVSEGVHDNNMWCLMATVDLLKHSIPDPSSLSLSHPQSSNLGSDKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G130950`
TK1151 ID	TkA04G130950
OH-1004 ID	LXL04_035435
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G130950`
Location	Chr04:34140890-34144295 (+)
Description	Similar to Smg9: Protein SMG9
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035435` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:1902554 serine/threonine protein kinase complex Cellular Component GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference	mmu:71997 rno:365215 sasa:100194832 xla:779402 xtr:100216177 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.535

Rank 1 · TkA04G130950 · TK1151

Cytoplasm0.374

Rank 2 · TkA04G130950 · TK1151

Cell membrane0.070

Rank 3 · TkA04G130950 · TK1151

Golgi apparatus0.057

Rank 4 · TkA04G130950 · TK1151

Lysosome / Vacuole0.051

Rank 5 · TkA04G130950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931NB-ARC82-115 aa

PF25683URGCP_GTPase91-118 aa

PF03193RsgA_GTPase93-116 aa

PF00005ABC_tran95-125 aa

PF03308MeaB95-114 aa

PF19993DO-GTPase296-115 aa

PF18751Ploopntkinase396-128 aa

PF01926MMR_HSR197-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G130950	`PF00931`	NB-ARC	82	115	0.00095	19.5
TkA04G130950	`PF25683`	URGCP_GTPase	91	118	0.17	11.3
TkA04G130950	`PF03193`	RsgA_GTPase	93	116	0.055	14.0
TkA04G130950	`PF00005`	ABC_tran	95	125	0.0071	17.7
TkA04G130950	`PF03308`	MeaB	95	114	0.033	13.9
TkA04G130950	`PF19993`	DO-GTPase2	96	115	0.036	14.5
TkA04G130950	`PF18751`	Ploopntkinase3	96	128	0.25	11.6
TkA04G130950	`PF01926`	MMR_HSR1	97	116	0.0045	17.8
TkA04G130950	`PF00350`	Dynamin_N	97	119	0.18	12.5
TkA04G130950	`PF19993`	DO-GTPase2	259	321	0.036	14.5
TkA04G130950	`PF25683`	URGCP_GTPase	283	318	0.17	11.3
TkA04G130950	`PF00005`	ABC_tran	286	306	0.0071	17.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card