Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1913 bp · TkA04G129730|TK1151|cDNA
GAACCTTCAAAAATGCTTGTACCCGGCGAATCATAGAGCGCCACATCAGCCATGAGTTGCATCGGCCGGGAAAGTAAATGGAGGTTTCAGGAGAAGCGTAAAATCACTTGAGCAGAGGCGGTGAGCATATGTACACAGGGAGCAGGCACCGGCATGATCGATCGACGGTAAAGATTCCGATTTCGACTCCGATAATTTAGTATCCGAAATTAGATCTGAATGGGTTGGGGAAGGGCGATTTACGAAGGAATTGTGGTGGT...
1407 bp · TkA04G129730|TK1151|CDS
ATGGGTTGGGGAAGGGCGATTTACGAAGGAATTGTGGTGGTTGGTTCTCTTTCGCTGCTTGCCTGGGCGGGTCTCTGGTTTTTGAACCAAAGACTATACAAAGAGTACGAAGAAAAACGGGTGCTGGTTCAGATCATCTTCAGTGTTGTTTTCGCCCTCTCTTGCAACCTCTTCGAGCTTGTCCTTTTTGAGATCATCCCTATCCTCTCCAAAGAGGCAAGATGGATAAACTGGAAGGTGGATTTATTTTGCTTGATAAC...
Protein
Download Protein FASTA468 aa · TkA04G129730|TK1151|PROTEIN
MGWGRAIYEGIVVVGSLSLLAWAGLWFLNQRLYKEYEEKRVLVQIIFSVVFALSCNLFELVLFEIIPILSKEARWINWKVDLFCLITLLVFMLPYYHCYLMLCKSGVRKRRAATGAVLFLFAFLYAFWRLGIHFPMPSPDKGFFTIPQLVSRIGVIGVTVMAVLSGFGAVNLPYSYLSLFIREIEEIEIKALERQLMQSIETSIGKKKKIILSQMEMERVQGQEESYKAGSFFKRIVGTVVRSVQDDQKEQDIRGLESEV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G129730 |
|---|---|
| TK1151 ID | TkA04G129730 |
| OH-1004 ID | LXL04_035452 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G129730 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:33766210-33769654 (+) | ||||||||||||||||||
| Description | Similar to GTG1: GPCR-type G protein 1 | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0009737 response to abscisic acid Biological Process GO:0009791 post-embryonic development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0015031 protein transport Biological Process GO:0051452 intracellular pH reduction Biological Process GO:0070417 cellular response to cold Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0030660 Golgi-associated vesicle membrane Cellular Component | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT1G64990 ath:AT4G27630 dosa:Os04g0600800 gga:418459 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12537GPHR_N10-18 aaPF12430ABA_GPCR37-57 aaPF12537GPHR_N143-209 aaPF15397DUF4618185-279 aaPF12537GPHR_N245-265 aaPF12430ABA_GPCR286-456 aaPF12537GPHR_N303-316 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G129730 | PF12537 | GPHR_N | 10 | 18 | 1.8e-21 | 76.7 |
| TkA04G129730 | PF12430 | ABA_GPCR | 37 | 57 | 1.2e-43 | 149.7 |
| TkA04G129730 | PF12537 | GPHR_N | 143 | 209 | 1.8e-21 | 76.7 |
| TkA04G129730 | PF15397 | DUF4618 | 185 | 279 | 0.87 | 9.7 |
| TkA04G129730 | PF12537 | GPHR_N | 245 | 265 | 1.8e-21 | 76.7 |
| TkA04G129730 | PF12430 | ABA_GPCR | 286 | 456 | 1.2e-43 | 149.7 |
| TkA04G129730 | PF12537 | GPHR_N | 303 | 316 | 1.8e-21 | 76.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9XIP7 | Arabidopsis thaliana | sp|Q9XIP7|GTG1_ARATH GPCR-type G protein 1 | 84.200% | Swiss-Prot | High |
Q0WQG8 | Arabidopsis thaliana | sp|Q0WQG8|GTG2_ARATH GPCR-type G protein 2 | 83.500% | Swiss-Prot | High |
A2XX57 | Oryza sativa subsp. indica | sp|A2XX57|COLD1_ORYSI GPCR-type G protein COLD1 | 81.800% | Swiss-Prot | High |
Q7X7S8 | Oryza sativa subsp. japonica | sp|Q7X7S8|COLD1_ORYSJ GPCR-type G protein COLD1 | 81.600% | Swiss-Prot | High |