TkA04G127800 | RubberDandelionOmics

Gene overview

TkA04G127800

Reference: TK1151 Chr: Chr04 Coordinates: 33231791-33233587 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1496 bp · TkA04G127800|TK1151|cDNA

ATAAACCCATGCATATATAATAAACCCTCCCCATTGCATTCATATCCTCCACAACACAAAAGCATGGCATTCCTTATTTCCTCCAAACAATCCTCCCTTTTCATCTTATTCATCTCAATCTTAGCCTTTTCAACTATAGCCCATGAGTTTTCGATCCTAGGATACGCCCCAGAGGATCTAACATCCATTCACAAAGTCGTCCACCTTTTCGAATCATGGATCAGTAAACACAGTAAATTGTACGAAAGTCTAGATGAGAA...

CDS

Download CDS FASTA

1053 bp · TkA04G127800|TK1151|CDS

ATGGCATTCCTTATTTCCTCCAAACAATCCTCCCTTTTCATCTTATTCATCTCAATCTTAGCCTTTTCAACTATAGCCCATGAGTTTTCGATCCTAGGATACGCCCCAGAGGATCTAACATCCATTCACAAAGTCGTCCACCTTTTCGAATCATGGATCAGTAAACACAGTAAATTGTACGAAAGTCTAGATGAGAAGCTACATAGATTCGAGATCTTCATGGACAACCTCAAGCACATTGATGACACAAATAGAAAAGT...

Protein

Download Protein FASTA

350 aa · TkA04G127800|TK1151|PROTEIN

MAFLISSKQSSLFILFISILAFSTIAHEFSILGYAPEDLTSIHKVVHLFESWISKHSKLYESLDEKLHRFEIFMDNLKHIDDTNRKVSNYWLGLNEFADLTHEEFKNKFLGLAPELKKTELSEDFIYRDFVDLPKSVDWRKKGAVSPVKNQGQCGSCWAFSTVAAVEGINQIVTGNLTVLSEQELIDCDTSFNNGCNGGLMDYAFAYIMRNGGLHKEEEYPYIMSEGTCDDKKDISEKVTITGYHDVPRNNEDSFLKALA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G127800`
TK1151 ID	TkA04G127800
OH-1004 ID	LXL04_035478
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G127800

Location Chr04:33231791-33233587 (+)

Description Similar to XCP1: Cysteine protease XCP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35350`	Cysteine protease involved in xylem tracheary element (TE) autolysis during xylogenesis in roots.	Cysteine proteases XCP1 and XCP2 aid micro-autolysis within the intact central vacuole during xylogenesis in Arabidopsis roots.2008 · DOI: 10.1111/j.1365-313x.2008.03592.x
`At1g20850`	Cysteine protease involved in xylem tracheary element (TE) autolysis during xylogenesis in roots.	Cysteine proteases XCP1 and XCP2 aid micro-autolysis within the intact central vacuole during xylogenesis in Arabidopsis roots.2008 · DOI: 10.1111/j.1365-313x.2008.03592.x PIRIN2 stabilizes cysteine protease XCP2 and increases susceptibility to the vascular pathogen Ralstonia solanacearum in Arabidopsis.2014 · DOI: 10.1111/tpj.12602
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035478 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010623 programmed cell death involved in cell development Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0140447 cytokine precursor processing Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ag:CAA66378

ath:AT1G20850

ath:AT1G47128

ath:AT4G35350

ath:AT5G43060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.675

Rank 1 · TkA04G127800 · TK1151

Cytoplasm0.165

Rank 2 · TkA04G127800 · TK1151

Extracellular0.148

Rank 3 · TkA04G127800 · TK1151

Endoplasmic reticulum0.122

Rank 4 · TkA04G127800 · TK1151

Cell membrane0.089

Rank 5 · TkA04G127800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28470PIK3AP1_C41-78 aa

PF10368YkyA41-99 aa

PF08246Inhibitor_I2949-105 aa

PF14131DUF429855-132 aa

PF00112Peptidase_C1133-348 aa

PF03051Peptidase_C1_2146-165 aa

PF28470PIK3AP1_C181-194 aa

PF03051Peptidase_C1_2304-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G127800	`PF28470`	PIK3AP1_C	41	78	0.019	15.5
TkA04G127800	`PF10368`	YkyA	41	99	0.23	11.9
TkA04G127800	`PF08246`	Inhibitor_I29	49	105	1.6e-19	70.7
TkA04G127800	`PF14131`	DUF4298	55	132	0.014	16.2
TkA04G127800	`PF00112`	Peptidase_C1	133	348	1.8e-81	274.2
TkA04G127800	`PF03051`	Peptidase_C1_2	146	165	0.0002	21.0
TkA04G127800	`PF28470`	PIK3AP1_C	181	194	0.019	15.5
TkA04G127800	`PF03051`	Peptidase_C1_2	304	329	0.0002	21.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65493`	Arabidopsis thaliana	sp\|O65493\|XCP1_ARATH Cysteine protease XCP1	68.700%	Swiss-Prot	High
`Q9LM66`	Arabidopsis thaliana	sp\|Q9LM66\|XCP2_ARATH Cysteine protease XCP2	69.700%	Swiss-Prot	High
`P43297`	Arabidopsis thaliana	sp\|P43297\|RD21A_ARATH Cysteine proteinase RD21A	54.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card