TkA04G124500 | RubberDandelionOmics

Gene overview

TkA04G124500

Reference: TK1151 Chr: Chr04 Coordinates: 32348970-32351452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1515 bp · TkA04G124500|TK1151|cDNA

ACTATTTGGCCACTTTGTCAAAATTTTCCTCTTTCATATATTTGGGATTGGGACGTTGGTCTCTCCTCAAATAATGTTGAACTGCACCTGGAGCATTCGCCGATTAAACCCAACCCCCACACTCTCACCATTTTCATTACCCAAAACCCCCAAATTTATCCGTAATCAAGCTTCATTTCGCTTAATGGCATCCACAACAACTCAATTACAGCAACAGCAATCGACTTCCGAGTTCTTGACGCAGAGACCCTATCATCCTC...

CDS

Download CDS FASTA

1275 bp · TkA04G124500|TK1151|CDS

ATGTTGAACTGCACCTGGAGCATTCGCCGATTAAACCCAACCCCCACACTCTCACCATTTTCATTACCCAAAACCCCCAAATTTATCCGTAATCAAGCTTCATTTCGCTTAATGGCATCCACAACAACTCAATTACAGCAACAGCAATCGACTTCCGAGTTCTTGACGCAGAGACCCTATCATCCTCCCTCATGGGCATCTAAACTCAATCCAATTCCTTCGCACGCCTTCACTCTTGGACATTTTCCAACTCCAATCCA...

Protein

Download Protein FASTA

424 aa · TkA04G124500|TK1151|PROTEIN

MLNCTWSIRRLNPTPTLSPFSLPKTPKFIRNQASFRLMASTTTQLQQQQSTSEFLTQRPYHPPSWASKLNPIPSHAFTLGHFPTPIHKWNLPNLPKDTEVWLKRDDLSGMQLSGNKVRKLEFLLADAVAQGADCIITIGGIQSNHCRATAVAAKYLNLDCFLILRTSKVLVEKDPGLTGNLLVERLVGAHIDLVSKEEYSRIGSNTLTNLLKEKLIKEGRKPYVIPVGGSNSLGTWGYIEAIREIENQVQKGTIKRSFDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G124500`
TK1151 ID	TkA04G124500
OH-1004 ID	LXL04_035539
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G124500

Location Chr04:32348970-32351452 (+)

Description Similar to Os02g0773300: Putative D-cysteine desulfhydrase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48420`	Catalyzes the production of hydrogen sulfide (H2S) from cysteine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0773300`	Catalyzes the production of hydrogen sulfide (H2S) from D- cysteine (D-cys).	Identification, characterization, and application of a d-cysteine desulfhydrase from rice seed (Oryza sativa L.).2023 · DOI: 10.1016/j.pep.2023.106341

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035539 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009693 ethylene biosynthetic process Biological Process

GO:0019447 D-cysteine catabolic process Biological Process

GO:1990170 stress response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008660 1-aminocyclopropane-1-carboxylate deaminase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0019148 D-cysteine desulfhydrase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G48420

dosa:Os02g0773300

osa:4330881

pfu:PF0010

pho:PH0054

tma:TM0225

tmi:THEMA_03600

tmm:Tmari_0223

tmw:THMA_0232

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.658

Rank 1 · TkA04G124500 · TK1151

Mitochondrion0.394

Rank 2 · TkA04G124500 · TK1151

Cytoplasm0.058

Rank 3 · TkA04G124500 · TK1151

Nucleus0.030

Rank 4 · TkA04G124500 · TK1151

Peroxisome0.018

Rank 5 · TkA04G124500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00291PALP78-386 aa

PF23281DAAF9_N105-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G124500	`PF00291`	PALP	78	386	2.2e-33	116.6
TkA04G124500	`PF23281`	DAAF9_N	105	161	0.093	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HYF3`	Arabidopsis thaliana	sp\|F4HYF3\|DCYD1_ARATH Bifunctional D-cysteine desulfhydrase/1-aminocyclopropane-1-carboxylate deaminase, mitochondrial	71.200%	Swiss-Prot	High
`Q6ZHE5`	Oryza sativa subsp. japonica	sp\|Q6ZHE5\|DCYD1_ORYSJ D-cysteine desulfhydrase 1, mitochondrial	76.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card