TkA04G123840 | RubberDandelionOmics

Gene overview

TkA04G123840

Reference: TK1151 Chr: Chr04 Coordinates: 32171285-32172218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA04G123840|TK1151|cDNA

CTAAATATGGATGCAATCACATATCTTGATACTATTAGATATGCCATTCGAAATGTTGTTCGACCATTTGTACCTACAGTCGCTATGAGAGTGTACTTTGGGATCAATGTGTTGATCAATAGTTGTGTACTTGAGACTTCTGTTGTTCAAAATGCTCCAACAGTTCACATTGGTGGTCAACCTAACGAGCTCTATACATTGGTTATGGTAGACCCGGATGCACCAAACCCAAATGAGCCACACTTTCGACAACTAGTATC...

CDS

Download CDS FASTA

513 bp · TkA04G123840|TK1151|CDS

ATGGATGCAATCACATATCTTGATACTATTAGATATGCCATTCGAAATGTTGTTCGACCATTTGTACCTACAGTCGCTATGAGAGTGTACTTTGGGATCAATGTGTTGATCAATAGTTGTGTACTTGAGACTTCTGTTGTTCAAAATGCTCCAACAGTTCACATTGGTGGTCAACCTAACGAGCTCTATACATTGGTTATGGTAGACCCGGATGCACCAAACCCAAATGAGCCACACTTTCGACAACTAGTATCATGGAT...

Protein

Download Protein FASTA

171 aa · TkA04G123840|TK1151|PROTEIN

MDAITYLDTIRYAIRNVVRPFVPTVAMRVYFGINVLINSCVLETSVVQNAPTVHIGGQPNELYTLVMVDPDAPNPNEPHFRQLVSWIVTNIPGWGSCEQGTEIASYERPNPEIGIHRYILILYKQQSRLTDMDTVNSRVCFNVDDFANKHNLGNPVGLAYFNVPRQANGIQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G123840`
TK1151 ID	TkA04G123840
OH-1004 ID	LXL04_035556
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.844 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G123840

Location Chr04:32171285-32172218 (+)

Description Similar to MFT1: Protein MOTHER of FT and TFL1 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18100`	May form complexes with phosphorylated ligands by interfering with kinases and their effectors (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0498800`	May form complexes with phosphorylated ligands by interfering with kinases and their effectors.	No verified direct reference in this release
`Os01g0111600`	May form complexes with phosphorylated ligands by interfering with kinases and their effectors.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035556 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010048 vernalization response Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010229 inflorescence development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048572 short-day photoperiodism Biological Process

KEGG gene cross-reference

ath:AT1G18100

bdi:100831221

dosa:Os01g0111600

dosa:Os06g0157700

dosa:Os06g0498800

osa:4326145

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.561

Rank 1 · TkA04G123840 · TK1151

Nucleus0.543

Rank 2 · TkA04G123840 · TK1151

Mitochondrion0.055

Rank 3 · TkA04G123840 · TK1151

Extracellular0.051

Rank 4 · TkA04G123840 · TK1151

Cell membrane0.037

Rank 5 · TkA04G123840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01161PBP48-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G123840	`PF01161`	PBP	48	157	1.1e-14	55.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFK7`	Arabidopsis thaliana	sp\|Q9XFK7\|MFT_ARATH Protein MOTHER of FT and TFL1	45.500%	Swiss-Prot	Medium
`Q656A5`	Oryza sativa subsp. japonica	sp\|Q656A5\|MFT1_ORYSJ Protein MOTHER of FT and TFL1 homolog 1	43.900%	Swiss-Prot	Medium
`Q9ASJ1`	Oryza sativa subsp. japonica	sp\|Q9ASJ1\|MFT2_ORYSJ Protein MOTHER of FT and TFL1 homolog 2	41.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card