TkA04G122440 | RubberDandelionOmics

Gene overview

TkA04G122440

Reference: TK1151 Chr: Chr04 Coordinates: 31799997-31801709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · TkA04G122440|TK1151|cDNA

AGAGGCACACTGAAATCATTTCCTATTGCTGTAAATACCTCGCTTTCTCTCCTCGTAACGGTCCGCCGTCACTTTTCACAGAAAATATTTGTGCCCGATTGGTTCACGTTCCTCTTAAGTCTTACCGCCCTTTTTACTCCGGTGATGCTCGGCGACGTACTCTGTGAACCTTCAAAACATTGGTCTCTCGGTTCCTCGTTATCTATCGGCCACTACGGCTCGGTAGCGCTTCGCCGTCATGCTTCTGATAGCAGCTTTCC...

CDS

Download CDS FASTA

1032 bp · TkA04G122440|TK1151|CDS

AGAGGCACACTGAAATCATTTCCTATTGCTGTAAATACCTCGCTTTCTCTCCTCGTAACGGTCCGCCGTCACTTTTCACAGAAAATATTTGTGCCCGATTGGTTCACGTTCCTCTTAAGTCTTACCGCCCTTTTTACTCCGGTGATGCTCGGCGACGTACTCTGTGAACCTTCAAAACATTGGTCTCTCGGTTCCTCGTTATCTATCGGCCACTACGGCTCGGTAGCGCTTCGCCGTCATGCTTCTGATAGCAGCTTTCC...

Protein

Download Protein FASTA

343 aa · TkA04G122440|TK1151|PROTEIN

RGTLKSFPIAVNTSLSLLVTVRRHFSQKIFVPDWFTFLLSLTALFTPVMLGDVLCEPSKHWSLGSSLSIGHYGSVALRRHASDSSFPILPATDSVDRRSIANGLNFCDSGVSASIWHAILPAGNDRGKHNPSPVGEGSWNVAWDVRPARWLHRPHTAWLLFGICAYLAAPPVELTESGEAVVVDDDDVNGNCTASVLENSVNYRVTGVPADGRCLFRAIAHMVCLRNGEEAPDENRQKLLADELRVQVVNELIKRRKEIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G122440`
TK1151 ID	TkA04G122440
OH-1004 ID	LXL04_035578
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.893 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G122440

Location Chr04:31799997-31801709 (+)

Description Similar to OTU4: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57810`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035578 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006307 DNA alkylation repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034122 negative regulation of toll-like receptor signaling pathway Biological Process

GO:0035871 protein K11-linked deubiquitination Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0070536 protein K63-linked deubiquitination Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:0140374 antiviral innate immune response Biological Process

GO:1903093 regulation of protein K48-linked deubiquitination Biological Process

GO:2000660 negative regulation of interleukin-1-mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G38025

ath:AT3G57810

hsa:54726

xla:444600

xtr:496720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.916

Rank 1 · TkA04G122440 · TK1151

Mitochondrion0.069

Rank 2 · TkA04G122440 · TK1151

Nucleus0.064

Rank 3 · TkA04G122440 · TK1151

Cytoplasm0.052

Rank 4 · TkA04G122440 · TK1151

Cell membrane0.020

Rank 5 · TkA04G122440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10275Peptidase_C65208-226 aa

PF02338OTU209-337 aa

PF29258OTU_Vertnin209-256 aa

PF17085UCMA226-270 aa

PF29258OTU_Vertnin258-297 aa

PF10275Peptidase_C65287-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G122440	`PF10275`	Peptidase_C65	208	226	0.65	10.1
TkA04G122440	`PF02338`	OTU	209	337	1.4e-23	84.5
TkA04G122440	`PF29258`	OTU_Vertnin	209	256	0.16	12.7
TkA04G122440	`PF17085`	UCMA	226	270	0.02	15.7
TkA04G122440	`PF29258`	OTU_Vertnin	258	297	0.16	12.7
TkA04G122440	`PF10275`	Peptidase_C65	287	340	0.65	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBZ4`	Arabidopsis thaliana	sp\|Q8LBZ4\|OTU4_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4	55.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card