TkA04G118590 | RubberDandelionOmics

Gene overview

TkA04G118590

Reference: TK1151 Chr: Chr04 Coordinates: 30859888-30862215 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · TkA04G118590|TK1151|cDNA

ATGAGCCGCCTAGACAGGATTTTGATCTCGAAGGAAGTGGGGAATATTTGGGAAAACATTGAAGTTATTTCCGATCATAGAAGATTTTCCGATCATTCTCCACTCATTATGAAGCAAATCAGTAGAAATTTTGGCCCCATCTCGTTCAAATTTTACAATTCTTGGCTTATGGATACCGAATGTATGGAGTTGATAAAACAGGCTTGGGAAAACTTCGAGCTTCAGGGGGACCATCTCAAAATGTATTACCTTATGAAGAA...

CDS

Download CDS FASTA

1236 bp · TkA04G118590|TK1151|CDS

ATGAGCCGCCTAGACAGGATTTTGATCTCGAAGGAAGTGGGGAATATTTGGGAAAACATTGAAGTTATTTCCGATCATAGAAGATTTTCCGATCATTCTCCACTCATTATGAAGCAAATCAGTAGAAATTTTGGCCCCATCTCGTTCAAATTTTACAATTCTTGGCTTATGGATACCGAATGTATGGAGTTGATAAAACAGGCTTGGGAAAACTTCGAGCTTCAGGGGGACCATCTCAAAATGTATTACCTTATGAAGAA...

Protein

Download Protein FASTA

411 aa · TkA04G118590|TK1151|PROTEIN

MSRLDRILISKEVGNIWENIEVISDHRRFSDHSPLIMKQISRNFGPISFKFYNSWLMDTECMELIKQAWENFELQGDHLKMYYLMKKLKFVKAEIIKWRKRCRVSREAHKIENQKIIDDVDKKIEAGTNSEQDVIERDIALENLWKREKQEQEDNKQKHKNKWCLEGDENSKMFYRNLNRKKRKSGIKGIMNEGTWHTDPNMDRFKRNQEDSWTQDLTNIKQLTDDQKVDIGDGEDTSFWEDRWLETVILKENFPCLYAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G118590`
TK1151 ID	TkA04G118590
OH-1004 ID	LXL04_005358
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.900
Protein coverage (%)	TK1151 51.582 / OH-1004 10.472 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G118590`
Location	Chr04:30859888-30862215 (+)
Description	Similar to LINE-1 retrotransposable element ORF2 protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005358` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003723 RNA binding Molecular Function GO:0003824 catalytic activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · TkA04G118590 · TK1151

Nucleus0.330

Rank 2 · TkA04G118590 · TK1151

Cell membrane0.119

Rank 3 · TkA04G118590 · TK1151

Mitochondrion0.046

Rank 4 · TkA04G118590 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA04G118590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11919PSME4_C154-164 aa

PF11919PSME4_C203-231 aa

PF11919PSME4_C256-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G118590	`PF11919`	PSME4_C	154	164	7.1	7.3
TkA04G118590	`PF11919`	PSME4_C	203	231	7.1	7.3
TkA04G118590	`PF11919`	PSME4_C	256	283	7.1	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card