TkA04G118480 | RubberDandelionOmics

Gene overview

TkA04G118480

Reference: TK1151 Chr: Chr04 Coordinates: 30818818-30819563 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA04G118480|TK1151|cDNA

ATGTACCGTGGGCTTTCTCCAACTATTCTTGCGTTCTTCCAACTGACGGTGTACTTTACTGTTTATGACTGGCTGAAAGGTTCACTTAGCTCTGATGATGGAAGTCATCAGCTGTCTTTTGGAGGGAATATGATAGCTGCTTCAGGGGCTGGAGTTGCAACAGTCATGTTTAGTGAGGTTGTAAGGGTGAGGCTGCAAGAACAGGGACACCATTCAGAGAAGAGGTACACGGGGATGGTGGATTGCATAAAGAAAGTGTT...

CDS

Download CDS FASTA

336 bp · TkA04G118480|TK1151|CDS

ATGTACCGTGGGCTTTCTCCAACTATTCTTGCGTTCTTCCAACTGACGGTGTACTTTACTGTTTATGACTGGCTGAAAGGTTCACTTAGCTCTGATGATGGAAGTCATCAGCTGTCTTTTGGAGGGAATATGATAGCTGCTTCAGGGGCTGGAGTTGCAACAGTCATGTTTAGTGAGGTTGTAAGGGTGAGGCTGCAAGAACAGGGACACCATTCAGAGAAGAGGTACACGGGGATGGTGGATTGCATAAAGAAAGTGTT...

Protein

Download Protein FASTA

111 aa · TkA04G118480|TK1151|PROTEIN

MYRGLSPTILAFFQLTVYFTVYDWLKGSLSSDDGSHQLSFGGNMIAASGAGVATVMFSEVVRVRLQEQGHHSEKRYTGMVDCIKKVLKGEGVRPICCGQLLLPSSLSPALR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G118480`
TK1151 ID	TkA04G118480
OH-1004 ID	LXL04_031527
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 69.369 / OH-1004 26.014 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G118480

Location Chr04:30818818-30819563 (-)

Description Similar to NDT1: Nicotinamide adenine dinucleotide transporter 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47490`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830
`At1g25380`	May mediate NAD⁺ import into chloroplasts.	Molecular identification and functional characterization of Arabidopsis thaliana mitochondrial and chloroplastic NAD+ carrier proteins.2009 · DOI: 10.1074/jbc.m109.041830

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031527 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015810 aspartate transmembrane transport Biological Process

GO:0015813 L-glutamate transmembrane transport Biological Process

GO:0035352 NAD transmembrane transport Biological Process

GO:0043132 NAD transport Biological Process

GO:0043490 malate-aspartate shuttle Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0005313 L-glutamate transmembrane transporter activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0015183 L-aspartate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G25380

ath:AT2G47490

ddi:DDB_G0283329

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.830

Rank 1 · TkA04G118480 · TK1151

Cytoplasm0.043

Rank 2 · TkA04G118480 · TK1151

Plastid0.035

Rank 3 · TkA04G118480 · TK1151

Peroxisome0.032

Rank 4 · TkA04G118480 · TK1151

Nucleus0.023

Rank 5 · TkA04G118480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr1-30 aa

PF00153Mito_carr37-93 aa

PF13995YebF59-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G118480	`PF00153`	Mito_carr	1	30	2.7e-13	50.2
TkA04G118480	`PF00153`	Mito_carr	37	93	2.7e-13	50.2
TkA04G118480	`PF13995`	YebF	59	85	0.21	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22261`	Arabidopsis thaliana	sp\|O22261\|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic	40.600%	Swiss-Prot	Medium
`Q8RWA5`	Arabidopsis thaliana	sp\|Q8RWA5\|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card