Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1050 bp · TkA04G116890|TK1151|cDNA
TTGGAATCTTTTGTTTTCTGAATAAACAGGGAGTGTTGGATTTCATTCAAATCGTTTCCCATAGCGCTGCAGACGAAGAATTTAGGAGAAATTTTTCGCACATTTCTTATCTTCAGCATTTCTTTTAGATTGGATTGTAGTAAGAGAAACCCTAAAAAATTAGAAGTTAGTAGAAACGAGATGAAGAGAGTGTTCGGTGTTAAGAAGGACAAAGAACCTCCTCCTTCCCTCAACGAAGCATCGGATCGGATCAATAAAAG...
696 bp · TkA04G116890|TK1151|CDS
ATGAAGAGAGTGTTCGGTGTTAAGAAGGACAAAGAACCTCCTCCTTCCCTCAACGAAGCATCGGATCGGATCAATAAAAGAGGTGAGTCAGTGGATGAGAAAATCAAGCGACTCGATGTAGAACTCACTCGATATAAAGACCAGATCAAAAGAACTCGTCCCGGGCCCGCCCAAGAAGCTGTGAAAGCTCGTGCAATGAGAATTCTCAAACAGAAACGAATGTATGAAGGACAACGTGACATGCTATACAACCAAACCTT...
Protein
Download Protein FASTA231 aa · TkA04G116890|TK1151|PROTEIN
MKRVFGVKKDKEPPPSLNEASDRINKRGESVDEKIKRLDVELTRYKDQIKRTRPGPAQEAVKARAMRILKQKRMYEGQRDMLYNQTFNLDQVAFASEGIKDAQQTMSALKSANKELKGMMKTVKIQDIDNLQDDMVDLMDVSNEIQESLGRTYNVPDDIDEEDLMGELDALEADMGMETGGEEGVPSYLQPDFNEELDLPSAPSGHAVPARGVKAEDEFGLPQVPRASLRG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G116890 |
|---|---|
| TK1151 ID | TkA04G116890 |
| OH-1004 ID | LXL04_035645 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 35.648Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G116890 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:30398785-30401068 (-) | |||||||||
| Description | Similar to VPS60-2: Vacuolar protein sorting-associated protein 60.2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001919 regulation of receptor recycling Biological Process GO:0006900 vesicle budding from membrane Biological Process GO:0006914 autophagy Biological Process GO:0006997 nucleus organization Biological Process GO:0007040 lysosome organization Biological Process GO:0007080 mitotic metaphase chromosome alignment Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0010824 regulation of centrosome duplication Biological Process GO:0015031 protein transport Biological Process GO:0031468 nuclear membrane reassembly Biological Process GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process GO:0036258 multivesicular body assembly Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G10640 ath:AT5G04850 mmu:76959 pon:100172361 rno:297995 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03357Snf712-206 aaPF02996Prefoldin16-53 aaPF13438DUF411317-27 aaPF06419COG6_N17-50 aaPF11488Lge119-51 aaPF08702Fib_alpha21-133 aaPF07028DUF131926-83 aaPF28934CCDC16029-126 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G116890 | PF03357 | Snf7 | 12 | 206 | 7.5e-50 | 169.6 |
| TkA04G116890 | PF02996 | Prefoldin | 16 | 53 | 0.37 | 11.5 |
| TkA04G116890 | PF13438 | DUF4113 | 17 | 27 | 0.22 | 12.2 |
| TkA04G116890 | PF06419 | COG6_N | 17 | 50 | 3.6 | 8.5 |
| TkA04G116890 | PF11488 | Lge1 | 19 | 51 | 0.11 | 13.5 |
| TkA04G116890 | PF08702 | Fib_alpha | 21 | 133 | 0.42 | 11.5 |
| TkA04G116890 | PF07028 | DUF1319 | 26 | 83 | 0.28 | 12.2 |
| TkA04G116890 | PF28934 | CCDC160 | 29 | 126 | 0.41 | 11.1 |
| TkA04G116890 | PF30842 | LEKR1 | 31 | 122 | 0.89 | 10.6 |
| TkA04G116890 | PF06419 | COG6_N | 79 | 146 | 3.6 | 8.5 |
| TkA04G116890 | PF13438 | DUF4113 | 84 | 111 | 0.22 | 12.2 |
| TkA04G116890 | PF02996 | Prefoldin | 99 | 122 | 0.37 | 11.5 |
| TkA04G116890 | PF30842 | LEKR1 | 99 | 149 | 0.89 | 10.6 |
| TkA04G116890 | PF11488 | Lge1 | 102 | 117 | 0.11 | 13.5 |
| TkA04G116890 | PF07028 | DUF1319 | 102 | 147 | 0.28 | 12.2 |
| TkA04G116890 | PF02996 | Prefoldin | 108 | 133 | 0.37 | 11.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.