TkA04G112580 | RubberDandelionOmics

Gene overview

TkA04G112580

Reference: TK1151 Chr: Chr04 Coordinates: 29251637-29253095 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

697 bp · TkA04G112580|TK1151|cDNA

ATGAGTGGAAGTATCACTGAAATGCTCAAAAAGTACATATTTTTTGCTGACAAGGTAGAAATTCAAGACATAAGTAAAAAGACTTGCTTATTTGCACTTATTGGACCCAAAAGCAATCAAGTAATAGCAGATTTGAATCTTGGTGACCTTATTGGACACACGATTGGTGGGGTGGCGGCGTACAATAACTTTAAGTTGAAAAGGGAAGTGGTTCGAGGTGTTACTGAGATGACTCAAAGGAGACATTGGGTGTTGGTGGT...

CDS

Download CDS FASTA

609 bp · TkA04G112580|TK1151|CDS

ATGAGTGGAAGTATCACTGAAATGCTCAAAAAGTACATATTTTTTGCTGACAAGGTAGAAATTCAAGACATAAGTAAAAAGACTTGCTTATTTGCACTTATTGGACCCAAAAGCAATCAAGTAATAGCAGATTTGAATCTTGGTGACCTTATTGGACACACGATTGGTGGGGTGGCGGCGTACAATAACTTTAAGTTGAAAAGGGAAGTGGTTCGAGGTGTTACTGAGATGACTCAAAGGAGACATTGGGTGTTGGTGGT...

Protein

Download Protein FASTA

202 aa · TkA04G112580|TK1151|PROTEIN

MSGSITEMLKKYIFFADKVEIQDISKKTCLFALIGPKSNQVIADLNLGDLIGHTIGGVAAYNNFKLKREVVRGVTEMTQRRHWVLVVIDMKAEKCYYLDSLKHSTINQQLKQMTIRAMLVYITQSGSDKRINLMWEQVRVPKQPGNTEFGYYVCKFMKEIIDNGLDVLVNANIGDGKQVYKDVDLDGIREDWAHYVSNFVLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G112580`
TK1151 ID	TkA04G112580
OH-1004 ID	LXL04_005047
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 58.911 / OH-1004 47.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G112580

Location Chr04:29251637-29253095 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60990`	Folate-dependent protein involved in Fe/S cluster biogenesis.	Mitochondrial and plastidial COG0354 proteins have folate-dependent functions in iron-sulphur cluster metabolism.2012 · DOI: 10.1093/jxb/err286

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005047 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.798

Rank 1 · TkA04G112580 · TK1151

Cytoplasm0.251

Rank 2 · TkA04G112580 · TK1151

Cell membrane0.040

Rank 3 · TkA04G112580 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA04G112580 · TK1151

Extracellular0.026

Rank 5 · TkA04G112580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01571GCV_T7-46 aa

PF22555DAM-like-phage161-135 aa

PF02902Peptidase_C4880-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G112580	`PF01571`	GCV_T	7	46	0.00079	19.2
TkA04G112580	`PF22555`	DAM-like-phage1	61	135	0.14	12.0
TkA04G112580	`PF02902`	Peptidase_C48	80	164	2.2e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q681Y3`	Arabidopsis thaliana	sp\|Q681Y3\|Y1099_ARATH Putative transferase At1g60990, chloroplastic	75.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card