TkA04G111670 | RubberDandelionOmics

Gene overview

TkA04G111670

Reference: TK1151 Chr: Chr04 Coordinates: 29043434-29048852 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2091 bp · TkA04G111670|TK1151|cDNA

AAACCCCTTCCCATCAGTTTTCAAGCGGACACAACTCATCCACTCTCTGTACCGCACTTTAAATTTTCCTACCCTCCCCCTCCCCATCTCCCTACACTTTACTCCCTCTCCTCCCTCCCACTTTCCCACCGATCTGAATCATGCCGCGAAGCTTCGCGGTCTGCATTGCCATCGGAGCTGTTCTCGTCGCCATTGCCGGCGCCGAAGATCCGTACAGGTTCTTCAACTGGAATGTTACCTACGGCGATATTTATCCTCTC...

CDS

Download CDS FASTA

1626 bp · TkA04G111670|TK1151|CDS

ATGCCGCGAAGCTTCGCGGTCTGCATTGCCATCGGAGCTGTTCTCGTCGCCATTGCCGGCGCCGAAGATCCGTACAGGTTCTTCAACTGGAATGTTACCTACGGCGATATTTATCCTCTCGGAGTCCGTCAACAGGGGATTTTGATCAATGGACAGTTTCCAGGACCTGATATTCACTCCGTCACAAATGACAATCTCATTATCAATGTCTTCAACAGCTTGTCCGAGCCTTTTCTTATCTCCTGGAATGGAGTTCAACA...

Protein

Download Protein FASTA

541 aa · TkA04G111670|TK1151|PROTEIN

MPRSFAVCIAIGAVLVAIAGAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLSEPFLISWNGVQQRRNSYEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFDEPAGDYTVLIGDWYKANHTLLRRILDGGHKIPFPDGILINGRGPNGASFTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLIEVEGTHTVQQTYSSLDVHCGQSYSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G111670`
TK1151 ID	TkA04G111670
OH-1004 ID	LXL04_035741
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G111670

Location Chr04:29043434-29048852 (-)

Description Similar to L-ascorbate oxidase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55560`	Probable oxidoreductase that may be involved in pollen tube growth.	Two Arabidopsis late pollen transcripts are detected in cytoplasmic granules.2017 · DOI: 10.1002/pld3.12
`At4g12420`	May be a monocopper oxidase of unknown specificity.	No verified direct reference in this release
`At4g25240`	Monocopper oxidase-like protein SKS1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035741 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55560

ath:AT4G12420

ath:AT5G51480

bna:106452325

nta:107766889

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.895

Rank 1 · TkA04G111670 · TK1151

Cytoplasm0.040

Rank 2 · TkA04G111670 · TK1151

Cell membrane0.030

Rank 3 · TkA04G111670 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA04G111670 · TK1151

Nucleus0.018

Rank 5 · TkA04G111670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732Cu-oxidase_332-145 aa

PF00394Cu-oxidase44-53 aa

PF07731Cu-oxidase_282-135 aa

PF00394Cu-oxidase103-127 aa

PF00394Cu-oxidase158-295 aa

PF07732Cu-oxidase_3190-222 aa

PF07731Cu-oxidase_2197-267 aa

PF14054DUF4249201-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G111670	`PF07732`	Cu-oxidase_3	32	145	4.2e-38	130.8
TkA04G111670	`PF00394`	Cu-oxidase	44	53	3.8e-46	157.8
TkA04G111670	`PF07731`	Cu-oxidase_2	82	135	1.9e-30	106.2
TkA04G111670	`PF00394`	Cu-oxidase	103	127	3.8e-46	157.8
TkA04G111670	`PF00394`	Cu-oxidase	158	295	3.8e-46	157.8
TkA04G111670	`PF07732`	Cu-oxidase_3	190	222	4.2e-38	130.8
TkA04G111670	`PF07731`	Cu-oxidase_2	197	267	1.9e-30	106.2
TkA04G111670	`PF14054`	DUF4249	201	311	0.047	14.0
TkA04G111670	`PF18560`	Lectin_like	202	278	0.012	16.5
TkA04G111670	`PF07731`	Cu-oxidase_2	376	514	1.9e-30	106.2
TkA04G111670	`PF07732`	Cu-oxidase_3	419	448	4.2e-38	130.8
TkA04G111670	`PF00394`	Cu-oxidase	432	455	3.8e-46	157.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMW3`	Arabidopsis thaliana	sp\|Q9SMW3\|SKS14_ARATH Protein SKU5 SIMILAR 14	53.200%	Swiss-Prot	High
`Q9SU40`	Arabidopsis thaliana	sp\|Q9SU40\|SKU5_ARATH Monocopper oxidase-like protein SKU5	50.500%	Swiss-Prot	High
`Q8VXX5`	Arabidopsis thaliana	sp\|Q8VXX5\|SKS1_ARATH Monocopper oxidase-like protein SKS1	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card