TkA04G111460 | RubberDandelionOmics

Gene overview

TkA04G111460

Reference: TK1151 Chr: Chr04 Coordinates: 28986391-28989260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2698 bp · TkA04G111460|TK1151|cDNA

CTCTCTCTCTCTCGCTCGCTTCTCTCTCTCTCTCTCTCGCCACCCTTGCATGGCAAGGGGTTTCTTACGAACAATTCCGTTCAAAATTAGGGCTTTCAGCTAATACTCCTGACAAGAATGTGAAGCTTCGAATTCAAATATGTCGAATGAGAAAGATTATGGTCTTATAGGCCCGTTCAAACCTATACCAAAGGAGGCTATATACTGCTCTCACATACATGAAAAACATCCTTTTGGGGTCTTCATCTACGGAGAAAGCC...

CDS

Download CDS FASTA

1110 bp · TkA04G111460|TK1151|CDS

ATGAGCTTAAGAGGTCAAGTCGAGCTTTTGCTGTTTATTCACTGGTTGGACTTTCAGATGATCGGGGTCCCACAGTTTACTATGTTTGTACTTTTGACAACGGTGATAACGGGAATAGCAACGCCGTTAATAAACGTAGTGTACAATCCAAACAGACCATACATGATCAATAAACGACGAAACATCCAACACACTCCTCCGAACACTGAACTCCCTGTTCTTGTGTGTTTCATCGATGAAGATAGTGTTCCTGGAATGAT...

Protein

Download Protein FASTA

369 aa · TkA04G111460|TK1151|PROTEIN

MSLRGQVELLLFIHWLDFQMIGVPQFTMFVLLTTVITGIATPLINVVYNPNRPYMINKRRNIQHTPPNTELPVLVCFIDEDSVPGMIHLLEVSNPTVHSPFLVYALHLVELVGRAAPMFIDHTGEQKDNNEENSERDYSGTVHKSFQNVHETKGDVIKVHSFTSVAPKRSMYQDVCELALNRKVSLIILPYNTSPMMRGVAGTEMVQNSVKSLNITVLDHAPCSVAMLVDKGGFKAPANLRLSVTIQYHFAMLFLGGADA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G111460`
TK1151 ID	TkA04G111460
OH-1004 ID	LXL04_035745
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.729 / OH-1004 43.345 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G111460

Location Chr04:28986391-28989260 (+)

Description Similar to CHX24: Cation/H(+) antiporter 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37060`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At5g58460`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At2g30240`	High-affinity potassium transporter that plays a role in K(+) acquisition.	No verified direct reference in this release
`At1g06970`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At2g28180`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G13620

ath:AT3G44900

ath:AT5G22900

ath:AT5G37060

ath:AT5G58460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.554

Rank 1 · TkA04G111460 · TK1151

Cytoplasm0.212

Rank 2 · TkA04G111460 · TK1151

Nucleus0.170

Rank 3 · TkA04G111460 · TK1151

Endoplasmic reticulum0.086

Rank 4 · TkA04G111460 · TK1151

Lysosome / Vacuole0.083

Rank 5 · TkA04G111460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23256CHX17_2nd103-232 aa

PF20951Flu_PB2_6th137-196 aa

PF23259CHX17_C247-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G111460	`PF23256`	CHX17_2nd	103	232	1.8e-38	132.2
TkA04G111460	`PF20951`	Flu_PB2_6th	137	196	0.1	12.9
TkA04G111460	`PF23259`	CHX17_C	247	368	5.9e-39	134.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1HDT2`	Arabidopsis thaliana	sp\|Q1HDT2\|CHX24_ARATH Cation/H(+) antiporter 24	48.500%	Swiss-Prot	Medium
`Q9FGH6`	Arabidopsis thaliana	sp\|Q9FGH6\|CHX25_ARATH Cation/H(+) antiporter 25	48.100%	Swiss-Prot	Medium
`O22920`	Arabidopsis thaliana	sp\|O22920\|CHX13_ARATH Cation/H(+) symporter 13	32.000%	Swiss-Prot	Medium
`Q9LMJ1`	Arabidopsis thaliana	sp\|Q9LMJ1\|CHX14_ARATH Cation/H(+) antiporter 14	31.800%	Swiss-Prot	Medium
`Q58P71`	Arabidopsis thaliana	sp\|Q58P71\|CHX8_ARATH Cation/H(+) antiporter 8	32.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card