Gene Card
Gene overview
cDNA / CDS / Protein Sequences
730 bp · TkA04G109900|TK1151|cDNA
TATAAATCCACCCTTTTCTCACCCCCATTTAGCCTTCATCTCAAACGAACAAACCCTAACCCTAAAATTCTTAAATTTTCCGCACTTAACTATGAAAGGAGGAAAGTCGACGAAGAAAGCTGATAGCAAGCTTACTGTGAAGAAAACTGCGCCTAAGGCAAAGGCTGCCAAGGATCCGAACAAGCCTAAGAGACCTGCTAGCGCATTTTTCGTTTTCATGGAGGACTTCAGGAAGCAGTACAAAGAGGAGCACCCCGAAA...
411 bp · TkA04G109900|TK1151|CDS
ATGAAAGGAGGAAAGTCGACGAAGAAAGCTGATAGCAAGCTTACTGTGAAGAAAACTGCGCCTAAGGCAAAGGCTGCCAAGGATCCGAACAAGCCTAAGAGACCTGCTAGCGCATTTTTCGTTTTCATGGAGGACTTCAGGAAGCAGTACAAAGAGGAGCACCCCGAAAACAAATCCGTAGCCGCGGTTGGGAAAGCTGGTGGCCAAAAATGGAAATCGATGTCTGAATCTGACAAAGCACCTTATGTTGCCAAAGCTGA...
Protein
Download Protein FASTA136 aa · TkA04G109900|TK1151|PROTEIN
MKGGKSTKKADSKLTVKKTAPKAKAAKDPNKPKRPASAFFVFMEDFRKQYKEEHPENKSVAAVGKAGGQKWKSMSESDKAPYVAKADKRKKEYEKAIDVYNNKPAAGGNDDDDSDKSKSEVNDEDDDGSEEDEDED
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G109900 |
|---|---|
| TK1151 ID | TkA04G109900 |
| OH-1004 ID | LXL04_036268 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 81.400 |
| Protein coverage (%) | TK1151 71.324 / OH-1004 56.069Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G109900 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:28573136-28574479 (+) | |||||||||
| Description | Similar to HMGB3: High mobility group B protein 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006325 chromatin organization Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0003677 DNA binding Molecular Function GO:0003682 chromatin binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0030527 structural constituent of chromatin Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G20693 ath:AT1G20696 ath:AT2G17560 gmx:547975 ini:109177607 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09011HMG_box_229-97 aaPF00505HMG_box32-101 aaPF24815HMG_WDHD135-83 aaPF04889Cwf_Cwc_1543-135 aaPF04931DNA_pol_phi108-136 aaPF24815HMG_WDHD1118-131 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G109900 | PF09011 | HMG_box_2 | 29 | 97 | 2e-13 | 51.5 |
| TkA04G109900 | PF00505 | HMG_box | 32 | 101 | 2.5e-22 | 79.8 |
| TkA04G109900 | PF24815 | HMG_WDHD1 | 35 | 83 | 3.9e-11 | 43.5 |
| TkA04G109900 | PF04889 | Cwf_Cwc_15 | 43 | 135 | 4.9 | 7.6 |
| TkA04G109900 | PF04931 | DNA_pol_phi | 108 | 136 | 8.0 | 5.2 |
| TkA04G109900 | PF24815 | HMG_WDHD1 | 118 | 131 | 3.9e-11 | 43.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.