TkA04G108970 | RubberDandelionOmics

Gene overview

TkA04G108970

Reference: TK1151 Chr: Chr04 Coordinates: 28321289-28323727 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1667 bp · TkA04G108970|TK1151|cDNA

ATCCTTATCAAAAATAACAAGTTCAGTCCCTCAACTTCAAGAGGAAAATGTTAGTTATGTGAGTGAAGTCCCACTAGAAGATCAAGAGAGTGAAGAAATCAGACAGTTTTTTGTGGGAAACTCTATTTTCACCCAACCACTCCATCAACAAGTCTCAATCACGAATTTAGAATTAACAAGTAATGATTATGAACTTGTGGGTCATGGTCATGGCCAATCAAGATTTACAAGTGTCGATTCTTCGTCATCAATATCGGGGA...

CDS

Download CDS FASTA

984 bp · TkA04G108970|TK1151|CDS

ATGACAGCGGCGGTTGCCGCCGGCGATGGTGTTGCGGAGGAGGAGAGCAAGAAGAAGGTTGTTATAAGATTAAGGGGAAAACCTGCTGCCATGAATACGACAAAGCATTTGTGGGCTGGAGCTGTTGCTGCCATGGTTTCTAGAACATTCGTTGCGCCACTCGAAAGACTAAAGCTGGAATACATGGTTCGTGGTGAACAGAAACATCTTTTTGACCTAATTAAATCAATCGCATCTTCTCAAGGTCTAAAAGGCTTCTG...

Protein

Download Protein FASTA

327 aa · TkA04G108970|TK1151|PROTEIN

MTAAVAAGDGVAEEESKKKVVIRLRGKPAAMNTTKHLWAGAVAAMVSRTFVAPLERLKLEYMVRGEQKHLFDLIKSIASSQGLKGFWKGNFVNILRTAPFKALNFCAYDSYRKQLLRLTGNEETTNFERLFAGAGAGMTASILCLPLDTIRTKLVAPGGESLGGVIGAFRHIIHTEGFFSLYKGLVPSILSMAPSSAVFYGVYDILKSAYLNSPEGKRRIKYMKEQGNDLNILEQLELGPMRTLLHGAVAGACAEVATYP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G108970`
TK1151 ID	TkA04G108970
OH-1004 ID	LXL04_035785
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 77.978 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G108970

Location Chr04:28321289-28323727 (+)

Description Similar to At5g64970: Probable mitochondrial adenine nucleotide transporter BTL3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64970`	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP.	No verified direct reference in this release
`At1g78180`	Probable mitochondrial adenylate carrier that catalyzes the transport of ATP, ADP and AMP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035785 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006839 mitochondrial transport Biological Process

GO:0015866 ADP transport Biological Process

GO:0015867 ATP transport Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0051503 adenine nucleotide transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G78180

ath:AT5G64970

ddi:DDB_G0285599

hsa:29957

mmu:229731

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.856

Rank 1 · TkA04G108970 · TK1151

Plastid0.047

Rank 2 · TkA04G108970 · TK1151

Cytoplasm0.047

Rank 3 · TkA04G108970 · TK1151

Nucleus0.028

Rank 4 · TkA04G108970 · TK1151

Peroxisome0.028

Rank 5 · TkA04G108970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr32-116 aa

PF02939UcrQ83-97 aa

PF00153Mito_carr124-212 aa

PF02939UcrQ169-208 aa

PF00153Mito_carr238-324 aa

PF02939UcrQ302-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G108970	`PF00153`	Mito_carr	32	116	9.9e-66	218.3
TkA04G108970	`PF02939`	UcrQ	83	97	0.12	13.0
TkA04G108970	`PF00153`	Mito_carr	124	212	9.9e-66	218.3
TkA04G108970	`PF02939`	UcrQ	169	208	0.12	13.0
TkA04G108970	`PF00153`	Mito_carr	238	324	9.9e-66	218.3
TkA04G108970	`PF02939`	UcrQ	302	318	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV81`	Arabidopsis thaliana	sp\|Q9LV81\|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3	74.800%	Swiss-Prot	High
`Q9C9R4`	Arabidopsis thaliana	sp\|Q9C9R4\|BRTL2_ARATH Probable mitochondrial adenine nucleotide transporter BTL2	69.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card