TkA04G107900 | RubberDandelionOmics

Gene overview

TkA04G107900

Reference: TK1151 Chr: Chr04 Coordinates: 28052869-28054015 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · TkA04G107900|TK1151|cDNA

GGAGCTATTGGTTTAGCTACTTACACTTTCAAGCCTTCAGAGCAACATGACTATGCGGTTTCTTCACCCGGGACGCTGGAAGGAACAAATTCGACCTTAGATATTACACTTTATGGCGGAGTGGTAGGTGGAGTGACTGCTCGAGTTTCAGTAGGAGGAGCAGGGGCAAGAACAAATGACTCAAGAACTTGTAGCGAGACCCAAAATGAGCTGGTTGTTGTTAGCCAAGTCACAAACGTTGACCAAGCCAAGATCGCTGA...

CDS

Download CDS FASTA

846 bp · TkA04G107900|TK1151|CDS

GGAGCTATTGGTTTAGCTACTTACACTTTCAAGCCTTCAGAGCAACATGACTATGCGGTTTCTTCACCCGGGACGCTGGAAGGAACAAATTCGACCTTAGATATTACACTTTATGGCGGAGTGGTAGGTGGAGTGACTGCTCGAGTTTCAGTAGGAGGAGCAGGGGCAAGAACAAATGACTCAAGAACTTGTAGCGAGACCCAAAATGAGCTGGTTGTTGTTAGCCAAGTCACAAACGTTGACCAAGCCAAGATCGCTGA...

Protein

Download Protein FASTA

281 aa · TkA04G107900|TK1151|PROTEIN

GAIGLATYTFKPSEQHDYAVSSPGTLEGTNSTLDITLYGGVVGGVTARVSVGGAGARTNDSRTCSETQNELVVVSQVTNVDQAKIAESAGACCVIVAESSESRGISRMVDPAVIKEIQRAVGVPVMAKTRVGQFVEAQILEAIGVDYIDENEVIAIADEDNFINKHNFRIPFICGCRDLGEGLRTQGDLSGSGNIVDTVRNMREVMGKIRVLTNMDEDEVFTFAKELGAPYDILAQTKQMGRLPVVHFAAGCITTPADAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G107900`
TK1151 ID	TkA04G107900
OH-1004 ID	LXL04_019153
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.700
Protein coverage (%)	TK1151 77.936 / OH-1004 70.501 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G107900

Location Chr04:28052869-28054015 (+)

Description Similar to PDX1: Probable pyridoxal 5'-phosphate synthase subunit PDX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16050`	The protein has no function in the formation of pyridoxal 5'-phosphate.	No verified direct reference in this release
`At5g01410`	Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia.	No verified direct reference in this release
`At2g38230`	Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019153 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006520 amino acid metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0006982 response to lipid hydroperoxide Biological Process

GO:0008615 pyridoxine biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010335 response to non-ionic osmotic stress Biological Process

GO:0015994 chlorophyll metabolic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0042823 pyridoxal phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G38230

ath:AT5G01410

dosa:Os07g0100200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA04G107900 · TK1151

Nucleus0.370

Rank 2 · TkA04G107900 · TK1151

Plastid0.107

Rank 3 · TkA04G107900 · TK1151

Cell membrane0.079

Rank 4 · TkA04G107900 · TK1151

Extracellular0.075

Rank 5 · TkA04G107900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03060NMO53-127 aa

PF01680SOR_SNZ73-250 aa

PF24057DUF7358101-140 aa

PF24057DUF7358200-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G107900	`PF03060`	NMO	53	127	0.034	14.2
TkA04G107900	`PF01680`	SOR_SNZ	73	250	4.6e-67	226.5
TkA04G107900	`PF24057`	DUF7358	101	140	0.26	11.7
TkA04G107900	`PF24057`	DUF7358	200	228	0.26	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZNR6`	Arabidopsis thaliana	sp\|Q9ZNR6\|PDX12_ARATH Pyridoxal 5'-phosphate synthase-like subunit PDX1.2	64.900%	Swiss-Prot	Medium
`Q8L940`	Arabidopsis thaliana	sp\|Q8L940\|PDX13_ARATH Pyridoxal 5'-phosphate synthase subunit PDX1.3	61.400%	Swiss-Prot	Medium
`O80448`	Arabidopsis thaliana	sp\|O80448\|PDX11_ARATH Pyridoxal 5'-phosphate synthase subunit PDX1.1	58.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card