TkA04G104820 | RubberDandelionOmics

Gene overview

TkA04G104820

Reference: TK1151 Chr: Chr04 Coordinates: 27279498-27286111 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2433 bp · TkA04G104820|TK1151|cDNA

ATGGATGTTAAAACGGCTTTTCTAAACGGGGATTTAGAAGAAGAAATATATATGGAGCAAACAGAAGGATATGTTGCCCCAGGACAAGAGTCCAAGGTTTGTAAACTTATCAAGTCATTATATGGGTTAAAACAAGCACCCAAACAATGGCATCAAAAGTTTGATCATGTGATGATGGAATCTGGATATCAGATCAATGAATGTGACAAGTGTGTTTATGTTAAAAACACAAGTGGTGGTTATGTAATCTTGTGCCTTTA...

CDS

Download CDS FASTA

2433 bp · TkA04G104820|TK1151|CDS

ATGGATGTTAAAACGGCTTTTCTAAACGGGGATTTAGAAGAAGAAATATATATGGAGCAAACAGAAGGATATGTTGCCCCAGGACAAGAGTCCAAGGTTTGTAAACTTATCAAGTCATTATATGGGTTAAAACAAGCACCCAAACAATGGCATCAAAAGTTTGATCATGTGATGATGGAATCTGGATATCAGATCAATGAATGTGACAAGTGTGTTTATGTTAAAAACACAAGTGGTGGTTATGTAATCTTGTGCCTTTA...

Protein

Download Protein FASTA

810 aa · TkA04G104820|TK1151|PROTEIN

MDVKTAFLNGDLEEEIYMEQTEGYVAPGQESKVCKLIKSLYGLKQAPKQWHQKFDHVMMESGYQINECDKCVYVKNTSGGYVILCLYVDDMLIVGSNDKMIQSTKNMLNARFDMKDMGLADVILGVKITRTENGLTLSQTHYVDKILEKFNSGDSSIARTPIDTSHHLSKNRGAGVEQVEYARIIGSLMYLMSCTRPDLAFAISRLSRYTSNPSAEHWKNSKSTSGYLFTLGGGAISWKSSKQTVIARSTMESEFIALDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G104820`
TK1151 ID	TkA04G104820
OH-1004 ID	LXL04_011844
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.400
Protein coverage (%)	TK1151 39.506 / OH-1004 23.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G104820

Location Chr04:27279498-27286111 (-)

Description Similar to DHFS: Dihydrofolate synthetase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006508 proteolysis Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0009396 folic acid-containing compound biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015074 DNA integration Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0042575 DNA polymerase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

KEGG gene cross-reference

ath:AT5G41480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.622

Rank 1 · TkA04G104820 · TK1151

Nucleus0.362

Rank 2 · TkA04G104820 · TK1151

Mitochondrion0.078

Rank 3 · TkA04G104820 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA04G104820 · TK1151

Cell membrane0.054

Rank 5 · TkA04G104820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07727RVT_21-162 aa

PF15252DUF4589239-250 aa

PF15252DUF4589277-330 aa

PF14223Retrotran_gag_2398-492 aa

PF15252DUF4589521-552 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G104820	`PF07727`	RVT_2	1	162	2.1e-47	162.5
TkA04G104820	`PF15252`	DUF4589	239	250	0.2	12.3
TkA04G104820	`PF15252`	DUF4589	277	330	0.2	12.3
TkA04G104820	`PF14223`	Retrotran_gag_2	398	492	1.1e-11	45.6
TkA04G104820	`PF15252`	DUF4589	521	552	0.2	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT94`	Arabidopsis thaliana	sp\|Q9ZT94\|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2	30.800%	Swiss-Prot	Low
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	31.100%	Swiss-Prot	Low
`P92519`	Arabidopsis thaliana	sp\|P92519\|M810_ARATH Uncharacterized mitochondrial protein AtMg00810	28.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card