TkA04G100610 | RubberDandelionOmics

Gene overview

TkA04G100610

Reference: TK1151 Chr: Chr04 Coordinates: 26197371-26197742 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA04G100610|TK1151|cDNA

ATGGAGCTTCTGCTTCGATTGAAGAAAATAGAAATTAGGTTGGGTAGGAAGAGGCACGTAGTGGATGAGAAGTATACAAGACCTCAAGGGTTGTCTCAACATAAGGATGTGGATCACAAGAAGCTTCGTAAGCTTATACTTGATTCCAAGCTCGCTCCTTGCTATCTAGGAGACGACGACTACATCTGCGATCTTAAAGAATGCCCAATTTGCTTTCTGGCGTGTGCTATTGATTTACATGTTTTTAATATGCATTTATT...

CDS

Download CDS FASTA

303 bp · TkA04G100610|TK1151|CDS

ATGGAGCTTCTGCTTCGATTGAAGAAAATAGAAATTAGGTTGGGTAGGAAGAGGCACGTAGTGGATGAGAAGTATACAAGACCTCAAGGGTTGTCTCAACATAAGGATGTGGATCACAAGAAGCTTCGTAAGCTTATACTTGATTCCAAGCTCGCTCCTTGCTATCTAGGAGACGACGACTACATCTGCGATCTTAAAGAATGCCCAATTTGCTTTCTGGCGTGTGCTATTGATTTACATGTTTTTAATATGCATTTATT...

Protein

Download Protein FASTA

100 aa · TkA04G100610|TK1151|PROTEIN

MELLLRLKKIEIRLGRKRHVVDEKYTRPQGLSQHKDVDHKKLRKLILDSKLAPCYLGDDDYICDLKECPICFLACAIDLHVFNMHLFHFLNHFSVLSCGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G100610`
TK1151 ID	TkA04G100610
OH-1004 ID	LXL04_028903
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G100610

Location Chr04:26197371-26197742 (+)

Description Similar to DA2: E3 ubiquitin-protein ligase DA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78420`	E3 ubiquitin-protein ligase involved in the regulation of organ and seed size.	No verified direct reference in this release
`At1g17145`	E3 ubiquitin-protein ligase involved in the regulation of organ and seed size.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A4GWX9`	E3 ubiquitin-protein ligase involved in the regulation of grain size.	No verified direct reference in this release
`Os02g0244100`	E3 ubiquitin-protein ligase involved in the regulation of grain size.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028903 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0046620 regulation of organ growth Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17145

ath:AT1G78420

dosa:Os02g0244100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.367

Rank 1 · TkA04G100610 · TK1151

Nucleus0.358

Rank 2 · TkA04G100610 · TK1151

Endoplasmic reticulum0.188

Rank 3 · TkA04G100610 · TK1151

Mitochondrion0.127

Rank 4 · TkA04G100610 · TK1151

Cell membrane0.095

Rank 5 · TkA04G100610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27641SIP5_N17-61 aa

PF27641SIP5_N64-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G100610	`PF27641`	SIP5_N	17	61	0.0005	20.5
TkA04G100610	`PF27641`	SIP5_N	64	74	0.0005	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YV5`	Arabidopsis thaliana	sp\|Q93YV5\|DA2_ARATH E3 ubiquitin-protein ligase DA2	72.100%	Swiss-Prot	Medium
`Q940G8`	Arabidopsis thaliana	sp\|Q940G8\|DA2L_ARATH E3 ubiquitin-protein ligase DA2L	64.600%	Swiss-Prot	Medium
`A4GWX9`	Oryza sativa subsp. indica	sp\|A4GWX9\|GW2_ORYSI E3 ubiquitin-protein ligase GW2	65.600%	Swiss-Prot	Medium
`B9F4Q9`	Oryza sativa subsp. japonica	sp\|B9F4Q9\|GW2_ORYSJ E3 ubiquitin-protein ligase GW2	65.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card