TkA04G093450 | RubberDandelionOmics

Gene overview

TkA04G093450

Reference: TK1151 Chr: Chr04 Coordinates: 24336479-24338084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · TkA04G093450|TK1151|cDNA

CTACTCCTCCCAACTAGATACCACAATACCACATATTGTATCGATTCTTCTTCCTCGCCGGAAGTTTCATCAAGCAGCCGGATGAAAGCCATTCAAAAGCTTATACAAGGCCAAGAATGGTCTCAAAATACACTTTGGTTGCCGGAAAACTTCGGTAACAACGTTTCATTCATGAGCAATTACAATATCAACCAGGTCTCTCAGACACTGACAAACAATACAAGTTCTACAAATCGTGTGGATGGAAATCGGAGATCAAT...

CDS

Download CDS FASTA

882 bp · TkA04G093450|TK1151|CDS

ATGAAAGCCATTCAAAAGCTTATACAAGGCCAAGAATGGTCTCAAAATACACTTTGGTTGCCGGAAAACTTCGGTAACAACGTTTCATTCATGAGCAATTACAATATCAACCAGGTCTCTCAGACACTGACAAACAATACAAGTTCTACAAATCGTGTGGATGGAAATCGGAGATCAATAGCCACGAATATGGTCAATAAAGTGAAAAACAAAAGAGGATGCTATATTAGAAAGCGCTCATGGACATCAACACAAGTAAC...

Protein

Download Protein FASTA

293 aa · TkA04G093450|TK1151|PROTEIN

MKAIQKLIQGQEWSQNTLWLPENFGNNVSFMSNYNINQVSQTLTNNTSSTNRVDGNRRSIATNMVNKVKNKRGCYIRKRSWTSTQVTSLIDDGYVWRKYGQKEITKAKHKRNYFRCTHKFDQGCQATKQVQQIDDEPPKYKITYNKHHTCKNYLSTPQIIFDSINLEDTSILISFKSNKLIDKEQVGSPFPSYTHEESNEALSSLGLRDNQLLLSEFRLPHNLTIMSDQPGASLMSTGLENEDVVSKGVYSPNFEMGYIH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G093450`
TK1151 ID	TkA04G093450
OH-1004 ID	LXL04_035949
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G093450

Location Chr04:24336479-24338084 (-)

Description Similar to WRKY70: Probable WRKY transcription factor 70

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56400`	Transcription factor involved in senescence, biotic and abiotic stress responses by modulating various phytohormones signaling pathways.	WRKY70 modulates the selection of signaling pathways in plant defense.2006 · DOI: 10.1111/j.1365-313x.2006.02712.x The WRKY70 transcription factor of Arabidopsis influences both the plant senescence and defense signaling pathways.2007 · DOI: 10.1007/s00425-006-0474-y Arabidopsis WRKY70 is required for full RPP4-mediated disease resistance and basal defense against Hyaloperonospora parasitica.2007 · DOI: 10.1094/mpmi-20-2-0120 Transcription factor WRKY70 displays important but no indispensable roles in jasmonate and salicylic acid signaling.2008 · DOI: 10.1111/j.1744-7909.2008.00653.x WRKY54 and WRKY70 co-operate as negative regulators of leaf senescence in Arabidopsis thaliana.2012 · DOI: 10.1093/jxb/err450 EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora.2012 · DOI: 10.1094/mpmi-05-11-0111 Arabidopsis WRKY46 coordinates with WRKY70 and WRKY53 in basal resistance against pathogen Pseudomonas syringae.2012 · DOI: 10.1016/j.plantsci.2011.12.003 Defense-related transcription factors WRKY70 and WRKY54 modulate osmotic stress tolerance by regulating stomatal aperture in Arabidopsis.2013 · DOI: 10.1111/nph.12378 Identification of a novel type of WRKY transcription factor binding site in elicitor-responsive cis-sequences from Arabidopsis thaliana.2014 · DOI: 10.1007/s11103-013-0136-y Density-dependent interference of aphids with caterpillar-induced defenses in Arabidopsis: involvement of phytohormones and transcription factors.2015 · DOI: 10.1093/pcp/pcu150 Transcription factors WRKY70 and WRKY11 served as regulators in rhizobacterium Bacillus cereus AR156-induced systemic resistance to Pseudomonas syringae pv. tomato DC3000 in Arabidopsis.2016 · DOI: 10.1093/jxb/erv445 Arabidopsis WRKY46, WRKY54, and WRKY70 Transcription Factors Are Involved in Brassinosteroid-Regulated Plant Growth and Drought Responses.2017 · DOI: 10.1105/tpc.17.00364 WRKY70 and its homolog WRKY54 negatively modulate the cell wall-associated defenses to necrotrophic pathogens in Arabidopsis.2017 · DOI: 10.1371/journal.pone.0183731
`At1g66550`	Transcription factor.	No verified direct reference in this release
`At1g66600`	Transcription factor.	No verified direct reference in this release
`At1g66560`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035949 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009625 response to insect Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

KEGG gene cross-reference

ath:AT2G40750

ath:AT3G56400

dosa:Os05g0322900

dosa:Os05g0571200

osa:4338413

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.888

Rank 1 · TkA04G093450 · TK1151

Cytoplasm0.205

Rank 2 · TkA04G093450 · TK1151

Cell membrane0.024

Rank 3 · TkA04G093450 · TK1151

Mitochondrion0.023

Rank 4 · TkA04G093450 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA04G093450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106WRKY70-82 aa

PF03106WRKY91-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G093450	`PF03106`	WRKY	70	82	1.5e-21	77.1
TkA04G093450	`PF03106`	WRKY	91	151	1.5e-21	77.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY00`	Arabidopsis thaliana	sp\|Q9LY00\|WRK70_ARATH Probable WRKY transcription factor 70	48.700%	Swiss-Prot	Low
`Q93WV7`	Arabidopsis thaliana	sp\|Q93WV7\|WRK67_ARATH Probable WRKY transcription factor 67	47.600%	Swiss-Prot	Low
`Q9C6H5`	Arabidopsis thaliana	sp\|Q9C6H5\|WRK63_ARATH Probable WRKY transcription factor 63	46.900%	Swiss-Prot	Low
`Q9C557`	Arabidopsis thaliana	sp\|Q9C557\|WRK64_ARATH Probable WRKY transcription factor 64	52.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card