RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G084640
Reference: TK1151 Chr: Chr04 Coordinates: 22201495-22212131 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2206 bp · TkA04G084640|TK1151|cDNA

GAACGACCGTGTTCCTCAATTCGTCAACCAACCGACGGAAGAGGAAAAGGCAACGAGGGCCGAGGCACGTCTTCACCACTTCATCTACCACTATCATTTTGCGTCAAAAAGCAAAAACACACAACTACTACTTCACTTTATTCTGAGTAGTGTACATCAATGGACGGAAGTGGAAATGACGCACCAGCGATCGGCATCGATCTCGGAACAACGTACTCATGTGTCGCCGTTTGGAAGCACGATCACATCCAAATCATCCC...

CDS

Download CDS FASTA

1959 bp · TkA04G084640|TK1151|CDS

AACGACCGTGTTCATCAATTCGTCAACTATCCGACGGAAGAGGAAACGAGGCACCGTCTTTACAACTTCATCAACCACTCTCTATCATTTTGCGTCAAAAAGCGAAAACAGGTTTACTTTATTCTGAGTACTGTAGTTATGGACGGAAGTGGAAATGACGCACCAGCGATCGGCATCGATCTCGGAACAACTTACTCATGTGTCGCCGTTTGGAAGCACGATCACATCCAAATCATCCCCAACGATCAGGGCAATAGAAC...

Protein

Download Protein FASTA

652 aa · TkA04G084640|TK1151|PROTEIN

NDRVHQFVNYPTEEETRHRLYNFINHSLSFCVKKRKQVYFILSTVVMDGSGNDAPAIGIDLGTTYSCVAVWKHDHIQIIPNDQGNRTTPSCVAFVDGERLIGDGAKNQVAMNPANTIFDAKRLIGRRFSDSKVQEDMKYWPFKVIEGSADTPKIVVSYKGQDKEFLAEEISSMILSKMKETADAYLGKSVVNAVVTVPAYFNDSQRQATKDAGTIAGLNIMRIINEPTAAAIAYGLDNKSDITSNMNVLVFDLGGGTFDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G084640
TK1151 IDTkA04G084640
OH-1004 IDLXL04_036005
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)96.400
Protein coverage (%)TK1151 93.558 / OH-1004 37.286
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G084640
LocationChr04:22201495-22212131 (-)
DescriptionSimilar to HSP70-1: Heat shock 70 kDa protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g12580 In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).
Comprehensive expression profile analysis of the Arabidopsis Hsp70 gene family.2001 · DOI: 10.1104/pp.126.2.789
Heat shock protein cognate 70-4 and an E3 ubiquitin ligase, CHIP, mediate plastid-destined precursor degradation through the ubiquitin-26S proteasome system in Arabidopsis.2009 · DOI: 10.1105/tpc.109.071548
At5g02490 In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions. No verified direct reference in this release
At1g56410 Heat shock 70 kDa protein 18. No verified direct reference in this release
At3g09440 In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036005 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006457 protein folding Biological Process
GO:0006950 response to stress Biological Process
GO:0009408 response to heat Biological Process
GO:0009615 response to virus Biological Process
GO:0010187 negative regulation of seed germination Biological Process
GO:0010286 heat acclimation Biological Process
GO:0042026 protein refolding Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0090332 stomatal closure Biological Process
GO:0098542 defense response to other organism Biological Process
KEGG gene cross-reference
ath:AT5G02500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613
Rank 1 · TkA04G084640 · TK1151
Nucleus0.298
Rank 2 · TkA04G084640 · TK1151
Mitochondrion0.111
Rank 3 · TkA04G084640 · TK1151
Cell membrane0.084
Rank 4 · TkA04G084640 · TK1151
Endoplasmic reticulum0.078
Rank 5 · TkA04G084640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP7056-650 aa
PF06723MreB_Mbl56-71 aa
PF14450FtsA58-86 aa
PF20887PWP3A-B_N138-195 aa
PF06723MreB_Mbl174-435 aa
PF04010DUF357186-206 aa
PF14450FtsA252-265 aa
PF10199Adaptin_binding268-292 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G084640PF00012HSP70566508.5e-223741.6
TkA04G084640PF06723MreB_Mbl56711.2e-1351.3
TkA04G084640PF14450FtsA58865.28.2
TkA04G084640PF20887PWP3A-B_N1381950.1114.1
TkA04G084640PF06723MreB_Mbl1744351.2e-1351.3
TkA04G084640PF04010DUF3571862060.03614.8
TkA04G084640PF14450FtsA2522655.28.2
TkA04G084640PF10199Adaptin_binding2682920.07614.5
TkA04G084640PF02782FGGY_C3684330.2911.7
TkA04G084640PF20887PWP3A-B_N4544820.1114.1
TkA04G084640PF20887PWP3A-B_N5425970.1114.1
TkA04G084640PF04010DUF3575556020.03614.8
TkA04G084640PF10199Adaptin_binding5606250.07614.5
TkA04G084640PF26154DUF80425716360.1712.9
TkA04G084640PF14450FtsA5745905.28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LHA8Arabidopsis thalianasp|Q9LHA8|HS704_ARATH Heat shock 70 kDa protein 464.000%Swiss-ProtHigh
P22954Arabidopsis thalianasp|P22954|HS702_ARATH Heat shock 70 kDa protein 262.400%Swiss-ProtHigh
Q9C7X7Arabidopsis thalianasp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 1862.400%Swiss-ProtHigh
O65719Arabidopsis thalianasp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 363.300%Swiss-ProtHigh

JBrowse

View in Genome Browser