Gene Card
Gene overview
cDNA / CDS / Protein Sequences
342 bp · TkA04G084520|TK1151|cDNA
TATATATATATATATATATATATATATATATATAACCGAGGAAGCCACCCGACCCGTCCTTTGGACGACCCGACTGACCCAACCTCGGGGCAACACGAACACCCGGTAAACTCGTGTGCCAGGCAACCCACCCTTTGGGTGTACCGGTGGCCATCCCTAATTGAAACCGGTGAGAGTCGAACCCATGACCAATCCTATGGAATGGTGGGAACGCTACCACTCGGCCATCAGGAGATGGTTTATATATATATATATATATA...
342 bp · TkA04G084520|TK1151|CDS
TATATATATATATATATATATATATATATATATAACCGAGGAAGCCACCCGACCCGTCCTTTGGACGACCCGACTGACCCAACCTCGGGGCAACACGAACACCCGGTAAACTCGTGTGCCAGGCAACCCACCCTTTGGGTGTACCGGTGGCCATCCCTAATTGAAACCGGTGAGAGTCGAACCCATGACCAATCCTATGGAATGGTGGGAACGCTACCACTCGGCCATCAGGAGATGGTTTATATATATATATATATATA...
Protein
Download Protein FASTA113 aa · TkA04G084520|TK1151|PROTEIN
YIYIYIYIYIYNRGSHPTRPLDDPTDPTSGQHEHPVNSCARQPTLWVYRWPSLIETGESRTHDQSYGMVGTLPLGHQEMVYIYIYIYIYIYIYIYIYIYIYIYIYFLGRLVYL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G084520 |
|---|---|
| TK1151 ID | TkA04G084520 |
| OH-1004 ID | LXL04_034869 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 95.800 |
| Protein coverage (%) | TK1151 62.832 / OH-1004 23.355Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G084520 |
|---|---|
| Location | Chr04:22146455-22146796 (+) |
| Description | Similar to TOR: Serine/threonine-protein kinase TOR |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009303 rRNA transcription Biological Process GO:0009615 response to virus Biological Process GO:0009630 gravitropism Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009745 sucrose mediated signaling Biological Process GO:0009791 post-embryonic development Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0010116 positive regulation of abscisic acid biosynthetic process Biological Process |
| KEGG gene cross-reference | ath:AT1G50030 dosa:Os05g0235300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11457DUF30212-11 aaPF11457DUF302180-103 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G084520 | PF11457 | DUF3021 | 2 | 11 | 4.0 | 8.4 |
| TkA04G084520 | PF11457 | DUF3021 | 80 | 103 | 4.0 | 8.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.