TkA04G082320 | RubberDandelionOmics

Gene overview

TkA04G082320

Reference: TK1151 Chr: Chr04 Coordinates: 21575010-21582662 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3852 bp · TkA04G082320|TK1151|cDNA

TCATACACATCAAAGAAAAGCTATGGCTTCTTCTCATAATATGGTAGTGTTGTTCTTCTTGTTGGCAATGACAAAACCATTTGGTGGTGAAGATAAAGTGAAGGTCTCATTGTACTATGAAGCTTTATGTCCATATTGTGCAAATTTCATCGTAAATCAATTGGGTAAAGCTTTGTATCAAGGGAACCTAATCTCCATCGTAGATCTCAACATGGTACCTTGGGGTAATACTCAAATTGCTCCTAACAATGGTTGGATTT...

CDS

Download CDS FASTA

717 bp · TkA04G082320|TK1151|CDS

ATGGCTTCTTCTCATAATATGGTAGTGTTGTTCTTCTTGTTGGCAATGACAAAACCATTTGGTGGTGAAGATAAAGTGAAGGTCTCATTGTACTATGAAGCTTTATGTCCATATTGTGCAAATTTCATCGTAAATCAATTGGGTAAAGCTTTGTATCAAGGGAACCTAATCTCCATCGTAGATCTCAACATGGTACCTTGGGGTAATACTCAAATTGCTCCTAACAATGGTTGGATTTGCCAGCATGGCCCTGATGAATG...

Protein

Download Protein FASTA

238 aa · TkA04G082320|TK1151|PROTEIN

MASSHNMVVLFFLLAMTKPFGGEDKVKVSLYYEALCPYCANFIVNQLGKALYQGNLISIVDLNMVPWGNTQIAPNNGWICQHGPDECLIDMVEACAIDLLPQPELRFELIKCIEELNLQGKHGEWKSCINALRIHPQPITDCYQSRKGVDLELRFADETNRLNPPHRFVPWVVVNDKPLQEDYQNFVAYICNAYKGQNKPKACEQHVLETNYFKEANSSHHVCYSGEMEHSLPFNHNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G082320`
TK1151 ID	TkA04G082320
OH-1004 ID	LXL04_000667
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.200
Protein coverage (%)	TK1151 88.235 / OH-1004 78.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G082320`
Location	Chr04:21575010-21582662 (-)
Description	Similar to GILT: Gamma-interferon-responsive lysosomal thiol protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000667` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0019886 antigen processing and presentation of exogenous peptide antigen via MHC class II Biological Process GO:0042590 antigen processing and presentation of exogenous peptide antigen via MHC class I Biological Process GO:0048147 negative regulation of fibroblast proliferation Biological Process GO:0050821 protein stabilization Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005829 cytosol Cellular Component GO:0030054 cell junction Cellular Component GO:0015036 disulfide oxidoreductase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016667 oxidoreductase activity, acting on a sulfur group of donors Molecular Function
KEGG gene cross-reference	ath:AT4G12960 bta:615930 cel:CELE_F37H8.5 mmu:65972 rno:290644 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.518

Rank 1 · TkA04G082320 · TK1151

Extracellular0.185

Rank 2 · TkA04G082320 · TK1151

Cytoplasm0.158

Rank 3 · TkA04G082320 · TK1151

Endoplasmic reticulum0.150

Rank 4 · TkA04G082320 · TK1151

Cell membrane0.113

Rank 5 · TkA04G082320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03227GILT27-131 aa

PF18633zf-CCCH_879-84 aa

PF18633zf-CCCH_8190-206 aa

PF03227GILT198-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G082320	`PF03227`	GILT	27	131	5e-29	101.5
TkA04G082320	`PF18633`	zf-CCCH_8	79	84	0.19	12.5
TkA04G082320	`PF18633`	zf-CCCH_8	190	206	0.19	12.5
TkA04G082320	`PF03227`	GILT	198	210	5e-29	101.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card