TkA04G081210 | RubberDandelionOmics

Gene overview

TkA04G081210

Reference: TK1151 Chr: Chr04 Coordinates: 21311920-21317416 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2350 bp · TkA04G081210|TK1151|cDNA

CTCAAATCCCTCCGCCTCAAAATGCATAAGAAGTATCGAAGAAATTGAAGTTCACATAAACACCCAAAAACCACTGACGATCTCTCGATGCTACCCCTCTCTCTCCTCACTTCGTAATAAATCTCCTCTTTCTCTGTTTCTCTTCGCTCGAAGGGAGTCCACCACAGTCTCAGCTCTCTCCAAGTGTTCAATCTCGGATCGATTTGATTGCTCTTCGCGATCGAAAATCGCAGATATGGCTTCTGTACCTCAACCTCCTG...

CDS

Download CDS FASTA

561 bp · TkA04G081210|TK1151|CDS

ATGGATCTACAGAAGAAAATCATTGATGTCCAAAAGATGGCTAATGAAACCGGTTTGGACTTCAGTGATCAAATCATCTCTCTAGAGAATAAATACCAGCAGGCTCTTAAAGATCTATATACACACTTGACTCCAATACAACGTGTTAGCATTGCAAGACACCCTAACAGACCAACTTTTCTTGACCATGTCTTCAACATTACTGATAAGTTTGTAGAGCTTCATGGTGACAGAGGTGGCTATGATGATCCTGCTATAGT...

Protein

Download Protein FASTA

186 aa · TkA04G081210|TK1151|PROTEIN

MDLQKKIIDVQKMANETGLDFSDQIISLENKYQQALKDLYTHLTPIQRVSIARHPNRPTFLDHVFNITDKFVELHGDRGGYDDPAIVTGIGTIDGRRFMFIGQQKGRNTKENIQRNFGMPTPHGYRKALRMMRYADHHGFPIVTFIDTPGAFADLKSEELGQGEAIAHNLRTMYGLKVPVVPYCDW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G081210`
TK1151 ID	TkA04G081210
OH-1004 ID	LXL04_036057
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.312 / OH-1004 29.672 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G081210

Location Chr04:21311920-21317416 (-)

Description Similar to CAC3: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38040`	Component of the acetyl coenzyme A carboxylase (ACC) complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036057 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:2001295 malonyl-CoA biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009317 acetyl-CoA carboxylase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003989 acetyl-CoA carboxylase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016743 carboxyl- or carbamoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38040

tel:tll1311

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.785

Rank 1 · TkA04G081210 · TK1151

Nucleus0.234

Rank 2 · TkA04G081210 · TK1151

Mitochondrion0.085

Rank 3 · TkA04G081210 · TK1151

Peroxisome0.052

Rank 4 · TkA04G081210 · TK1151

Cell membrane0.046

Rank 5 · TkA04G081210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03255ACCA2-181 aa

PF04158Sof130-54 aa

PF01039Carboxyl_trans84-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G081210	`PF03255`	ACCA	2	181	9.6e-74	249.0
TkA04G081210	`PF04158`	Sof1	30	54	0.19	12.7
TkA04G081210	`PF01039`	Carboxyl_trans	84	181	2.7e-05	23.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD43`	Arabidopsis thaliana	sp\|Q9LD43\|ACCA_ARATH Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic	86.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card