TkA04G080900 | RubberDandelionOmics

Gene overview

TkA04G080900

Reference: TK1151 Chr: Chr04 Coordinates: 21238406-21245002 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2199 bp · TkA04G080900|TK1151|cDNA

GAACGTTATTAACGTCTGGCCACTATATATACTCTTCAATTTCTCCATTTCTCTCACACTCAATTGAAATCAAACTTTTCAATAAAAATGGATACTAGTATCGATAATGTAGATGTTGTTACTTCTCCCAATGGCAATGTCGGTTCTCCTCCAAAAAGCGGAGGTGTTAGTTCCGTACAGTCCTCCGTACAATTTAACTCCTCCGAAGCCACACTTGGCCACCACCTCGCCCGCCGCCTTGTTCAAATTGGTGTCTCCGA...

CDS

Download CDS FASTA

1812 bp · TkA04G080900|TK1151|CDS

ATGGATACTAGTATCGATAATGTAGATGTTGTTACTTCTCCCAATGGCAATGTCGGTTCTCCTCCAAAAAGCGGAGGTGTTAGTTCCGTACAGTCCTCCGTACAATTTAACTCCTCCGAAGCCACACTTGGCCACCACCTCGCCCGCCGCCTTGTTCAAATTGGTGTCTCCGACGTATTTTCAGTTCCAGGCGACTTCAATTTAACTTTGCTGGATCATCTCATCGCAGAACCAGGGCTCAATCTCATTGGATGCTGTAA...

Protein

Download Protein FASTA

603 aa · TkA04G080900|TK1151|PROTEIN

MDTSIDNVDVVTSPNGNVGSPPKSGGVSSVQSSVQFNSSEATLGHHLARRLVQIGVSDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSANLPVICIVGGPNSNDYGTNRILHHTIGLPDFSRELRCFQTVTCYQAVVNNLEDAHELIDKAIYTALKESKPVYISVACNLPSIPHHTFSSEPIPMSLSPKLSNNLGLKAAVEAAAVFLNKAVKPVMVGGPKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G080900`
TK1151 ID	TkA04G080900
OH-1004 ID	LXL04_036093
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.900
Protein coverage (%)	TK1151 100.000 / OH-1004 80.749 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G080900

Location Chr04:21238406-21245002 (+)

Description Similar to PDC1: Pyruvate decarboxylase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33070`	May play a role in ethanolic fermentation during anoxia.	The pyruvate decarboxylase1 gene of Arabidopsis is required during anoxia but not other environmental stresses.2003 · DOI: 10.1104/pp.102.016907
`At5g01320`	Pyruvate decarboxylase 4.	No verified direct reference in this release
`At5g54960`	Pyruvate decarboxylase 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFI3`	Pyruvate decarboxylase 2.	No verified direct reference in this release
`Os03g0293500`	Pyruvate decarboxylase 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036093 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000949 aromatic amino acid family catabolic process to alcohol via Ehrlich pathway Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0006950 response to stress Biological Process

GO:0034059 response to anoxia Biological Process

GO:0036293 response to decreased oxygen levels Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090548 response to nitrate starvation Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G33070

ath:AT5G01320

ath:AT5G54960

dosa:Os03g0293500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.731

Rank 1 · TkA04G080900 · TK1151

Nucleus0.365

Rank 2 · TkA04G080900 · TK1151

Mitochondrion0.066

Rank 3 · TkA04G080900 · TK1151

Cell membrane0.057

Rank 4 · TkA04G080900 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA04G080900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02776TPP_enzyme_N42-147 aa

PF02775TPP_enzyme_C173-204 aa

PF00205TPP_enzyme_M239-356 aa

PF02775TPP_enzyme_C416-433 aa

PF02775TPP_enzyme_C449-574 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G080900	`PF02776`	TPP_enzyme_N	42	147	8.7e-30	103.7
TkA04G080900	`PF02775`	TPP_enzyme_C	173	204	5.4e-17	62.7
TkA04G080900	`PF00205`	TPP_enzyme_M	239	356	4e-22	79.1
TkA04G080900	`PF02775`	TPP_enzyme_C	416	433	5.4e-17	62.7
TkA04G080900	`PF02775`	TPP_enzyme_C	449	574	5.4e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82647`	Arabidopsis thaliana	sp\|O82647\|PDC1_ARATH Pyruvate decarboxylase 1	78.600%	Swiss-Prot	High
`Q9M040`	Arabidopsis thaliana	sp\|Q9M040\|PDC4_ARATH Pyruvate decarboxylase 4	78.100%	Swiss-Prot	High
`Q9FFT4`	Arabidopsis thaliana	sp\|Q9FFT4\|PDC2_ARATH Pyruvate decarboxylase 2	77.100%	Swiss-Prot	High
`A2XFI3`	Oryza sativa subsp. indica	sp\|A2XFI3\|PDC2_ORYSI Pyruvate decarboxylase 2	80.500%	Swiss-Prot	High
`Q10MW3`	Oryza sativa subsp. japonica	sp\|Q10MW3\|PDC2_ORYSJ Pyruvate decarboxylase 2	80.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card