TkA04G080530 | RubberDandelionOmics

Gene overview

TkA04G080530

Reference: TK1151 Chr: Chr04 Coordinates: 21130660-21132066 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · TkA04G080530|TK1151|cDNA

ATGGAGGACGGACTTTCCCAAATTACCCTCACTGACCGCATCAAGCTAAACGTCGGCGGGAAGCTGTTCGAGACCACCATCTCCACCCTCCGTTCCGGCGGACCAGATTCGCTCCTAGCTGCCCTCTCCAATCGGCAGGTACAGTCTTCAAACCCGGTGTTTATTGATCGAGATCCCGAGATATTCTCTGTCCTTCTATCCCTCCTCCGCACCAATCGCCTTCCGTCAACCTCCCGCCGGTTCACGGATCAAGAGCTCTC...

CDS

Download CDS FASTA

1407 bp · TkA04G080530|TK1151|CDS

ATGGAGGACGGACTTTCCCAAATTACCCTCACTGACCGCATCAAGCTAAACGTCGGCGGGAAGCTGTTCGAGACCACCATCTCCACCCTCCGTTCCGGCGGACCAGATTCGCTCCTAGCTGCCCTCTCCAATCGGCAGGTACAGTCTTCAAACCCGGTGTTTATTGATCGAGATCCCGAGATATTCTCTGTCCTTCTATCCCTCCTCCGCACCAATCGCCTTCCGTCAACCTCCCGCCGGTTCACGGATCAAGAGCTCTC...

Protein

Download Protein FASTA

468 aa · TkA04G080530|TK1151|PROTEIN

MEDGLSQITLTDRIKLNVGGKLFETTISTLRSGGPDSLLAALSNRQVQSSNPVFIDRDPEIFSVLLSLLRTNRLPSTSRRFTDQELSDEASYYGIESQLKSAMLPNPLSGIDASVVASIRPASDGVVSAFTTIDDGSVWIAHGGQISVYDWNLTHAGTVRTHLDSITSIRQVTPSSMAAIACDVASGVHFYNFANGRRVGSVEWTDPTDPRIYKARVTAIADSLDSVFAAFDAHNKENSVLAIDKSTLQVTSEIGRQSGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G080530`
TK1151 ID	TkA04G080530
OH-1004 ID	LXL04_036074
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G080530

Location Chr04:21130660-21132066 (-)

Description Similar to At3g09030: BTB/POZ domain-containing protein At3g09030

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09030`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Arabidopsis BTB/POZ protein-dependent PENETRATION3 trafficking and disease susceptibility.2017 · DOI: 10.1038/s41477-017-0039-z
`At5g41330`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g30940`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g24240`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036074 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G24240

ath:AT3G09030

ath:AT4G30940

ath:AT5G41330

dre:436601

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · TkA04G080530 · TK1151

Nucleus0.408

Rank 2 · TkA04G080530 · TK1151

Peroxisome0.078

Rank 3 · TkA04G080530 · TK1151

Cell membrane0.057

Rank 4 · TkA04G080530 · TK1151

Lysosome / Vacuole0.056

Rank 5 · TkA04G080530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02214BTB_214-98 aa

PF16819DUF5074113-199 aa

PF25279Beta_prop_At2g24240129-457 aa

PF16819DUF5074215-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G080530	`PF02214`	BTB_2	14	98	3.8e-15	56.7
TkA04G080530	`PF16819`	DUF5074	113	199	0.17	11.9
TkA04G080530	`PF25279`	Beta_prop_At2g24240	129	457	4.9e-13	49.4
TkA04G080530	`PF16819`	DUF5074	215	282	0.17	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7R7`	Arabidopsis thaliana	sp\|Q9S7R7\|EAP3_ARATH Protein ENDOPLASMIC RETICULUM-ARRESTED PEN3	60.600%	Swiss-Prot	High
`Q9FN67`	Arabidopsis thaliana	sp\|Q9FN67\|Y5133_ARATH BTB/POZ domain-containing protein At5g41330	33.600%	Swiss-Prot	Medium
`O65555`	Arabidopsis thaliana	sp\|O65555\|Y4094_ARATH BTB/POZ domain-containing protein At4g30940	25.800%	Swiss-Prot	Low
`Q9ZUH1`	Arabidopsis thaliana	sp\|Q9ZUH1\|Y2424_ARATH BTB/POZ domain-containing protein At2g24240	23.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card