TkA04G079590 | RubberDandelionOmics

Gene overview

TkA04G079590

Reference: TK1151 Chr: Chr04 Coordinates: 20891445-20891753 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA04G079590|TK1151|cDNA

ATGTTAGCGATCCTTGAAATCAAATGGTCTGGAATTGAGCTCGAAGAATGGTGGAGAAACGAACAGTTTTGGTTAATCGGCGGTACTAGCGCTCATCTGGCCGTCGTTCTTCAAGGTCTTCTGAAGGTGGTTGCCGGAATTGAAATCTCGTTCACTTTGACGTCGAAATCAGGGGGTGAAGAAGACGATAAGTTTGCGAATCTGATCTGGATTGCTTTTGTGGTGAGGGCTGATTGCGATTGCGACGATTGTTTTTGTGT...

CDS

Download CDS FASTA

309 bp · TkA04G079590|TK1151|CDS

ATGTTAGCGATCCTTGAAATCAAATGGTCTGGAATTGAGCTCGAAGAATGGTGGAGAAACGAACAGTTTTGGTTAATCGGCGGTACTAGCGCTCATCTGGCCGTCGTTCTTCAAGGTCTTCTGAAGGTGGTTGCCGGAATTGAAATCTCGTTCACTTTGACGTCGAAATCAGGGGGTGAAGAAGACGATAAGTTTGCGAATCTGATCTGGATTGCTTTTGTGGTGAGGGCTGATTGCGATTGCGACGATTGTTTTTGTGT...

Protein

Download Protein FASTA

102 aa · TkA04G079590|TK1151|PROTEIN

MLAILEIKWSGIELEEWWRNEQFWLIGGTSAHLAVVLQGLLKVVAGIEISFTLTSKSGGEEDDKFANLIWIAFVVRADCDCDDCFCVVRADCDHDFFALGCD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G079590`
TK1151 ID	TkA04G079590
OH-1004 ID	LXL04_026119
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.600
Protein coverage (%)	TK1151 66.667 / OH-1004 5.949 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G079590

Location Chr04:20891445-20891753 (-)

Description Similar to CSLD3: Cellulose synthase-like protein D3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03050`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	AtCSLD3, a cellulose synthase-like gene important for root hair growth in arabidopsis.2001 · DOI: 10.1104/pp.126.2.575
`At5g16910`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At1g32180`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YU42`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os06g0111800`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026119 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0048767 root hair elongation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03050

ath:AT5G16910

dosa:Os06g0111800

dosa:Os10g0578200

osa:4339895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.371

Rank 1 · TkA04G079590 · TK1151

Nucleus0.276

Rank 2 · TkA04G079590 · TK1151

Mitochondrion0.145

Rank 3 · TkA04G079590 · TK1151

Cell membrane0.144

Rank 4 · TkA04G079590 · TK1151

Endoplasmic reticulum0.118

Rank 5 · TkA04G079590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt1-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G079590	`PF03552`	Cellulose_synt	1	71	2.2e-33	116.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9M4`	Arabidopsis thaliana	sp\|Q9M9M4\|CSLD3_ARATH Cellulose synthase-like protein D3	87.000%	Swiss-Prot	Medium
`Q9LFL0`	Arabidopsis thaliana	sp\|Q9LFL0\|CSLD2_ARATH Cellulose synthase-like protein D2	81.900%	Swiss-Prot	Medium
`Q9FVR3`	Arabidopsis thaliana	sp\|Q9FVR3\|CSLD6_ARATH Putative cellulose synthase-like protein D6	71.300%	Swiss-Prot	High
`A2YU42`	Oryza sativa subsp. indica	sp\|A2YU42\|CSLD2_ORYSI Cellulose synthase-like protein D2	88.400%	Swiss-Prot	Medium
`Q9LHZ7`	Oryza sativa subsp. japonica	sp\|Q9LHZ7\|CSLD2_ORYSJ Cellulose synthase-like protein D2	88.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card