TkA04G079160 | RubberDandelionOmics

Gene overview

TkA04G079160

Reference: TK1151 Chr: Chr04 Coordinates: 20762403-20767904 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2350 bp · TkA04G079160|TK1151|cDNA

CTCAAATCCCTCCGCCTCAAAATGCATAAGAAGTATCGAAGAAATTGAAGTTCACATAAACACCCAAAAACCACTGACGATCTTCTCGATGCTACCCCTCTCTCTCCTCACTTCGTAATAAATCTCCTCTTTCTCTGTTTCTCTTCGCTCGAAGGGAGTCCACCACAGTCTCAGCTCTCTCCAAGTGTTCAATCTCGGATCGATTTGATTGCTCTTCGCGATCGAAAATCGCAGATATGGCTTCTGTACCTCAACCTCCT...

CDS

Download CDS FASTA

1833 bp · TkA04G079160|TK1151|CDS

ATGGCTTCTGTACCTCAACCTCCTGTCACCTTTTCTGGAAGTTTGTCTTCTGGAACCTCAGCTTCAGATCTTCTTCGAAGCTCAAGTAATGGCATCAATGGCATACCACTAAGAACATTAGGCCGAGGGCATGTAAACGCAGGTAGGAAGAGTTTAAGTATCACTGCAAAGGTAAGGAAGGTGAAGAAACACGATTACCCATGGCCCCAGGATCCTGATCCCAACGTGAAGGGTGGAGTTCTCAGTCATCTATCCTCATT...

Protein

Download Protein FASTA

610 aa · TkA04G079160|TK1151|PROTEIN

MASVPQPPVTFSGSLSSGTSASDLLRSSSNGINGIPLRTLGRGHVNAGRKSLSITAKVRKVKKHDYPWPQDPDPNVKGGVLSHLSSFKPLKEKPKPVTLEFEKPLMDLQKKIIDVQKMANETGLDFSDQIISLENKYQQALKDLYTHLTPIQRVSIARHPNRPTFLDHVFNITDKFVELHGDRGGYDDPAIVTGIGTIDGRRFMFIGQQKGRNTKENIQRNFGMPTPHGYRKALRMMRYADHHGFPIVTFIDTPGAFADL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G079160`
TK1151 ID	TkA04G079160
OH-1004 ID	LXL04_036057
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G079160

Location Chr04:20762403-20767904 (+)

Description Similar to CAC3: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38040`	Component of the acetyl coenzyme A carboxylase (ACC) complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036057 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:2001295 malonyl-CoA biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009317 acetyl-CoA carboxylase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003989 acetyl-CoA carboxylase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016743 carboxyl- or carbamoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38040

tel:tll1311

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.901

Rank 1 · TkA04G079160 · TK1151

Mitochondrion0.117

Rank 2 · TkA04G079160 · TK1151

Cytoplasm0.038

Rank 3 · TkA04G079160 · TK1151

Nucleus0.019

Rank 4 · TkA04G079160 · TK1151

Peroxisome0.018

Rank 5 · TkA04G079160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03255ACCA99-407 aa

PF21008AIF-1107-122 aa

PF23055DUF7041117-143 aa

PF01039Carboxyl_trans189-339 aa

PF06833MdcE242-350 aa

PF21008AIF-1423-483 aa

PF26666DUF8221424-463 aa

PF03255ACCA427-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G079160	`PF03255`	ACCA	99	407	5.5e-131	437.1
TkA04G079160	`PF21008`	AIF-1	107	122	7.9	7.5
TkA04G079160	`PF23055`	DUF7041	117	143	0.1	13.7
TkA04G079160	`PF01039`	Carboxyl_trans	189	339	1.7e-10	40.9
TkA04G079160	`PF06833`	MdcE	242	350	0.0015	19.0
TkA04G079160	`PF21008`	AIF-1	423	483	7.9	7.5
TkA04G079160	`PF26666`	DUF8221	424	463	4.9	8.1
TkA04G079160	`PF03255`	ACCA	427	460	5.5e-131	437.1
TkA04G079160	`PF21008`	AIF-1	506	547	7.9	7.5
TkA04G079160	`PF06833`	MdcE	508	519	0.0015	19.0
TkA04G079160	`PF26666`	DUF8221	512	596	4.9	8.1
TkA04G079160	`PF23055`	DUF7041	514	560	0.1	13.7
TkA04G079160	`PF16428`	DUF5025	524	585	0.086	13.5
TkA04G079160	`PF03255`	ACCA	531	575	5.5e-131	437.1
TkA04G079160	`PF23055`	DUF7041	561	596	0.1	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD43`	Arabidopsis thaliana	sp\|Q9LD43\|ACCA_ARATH Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, chloroplastic	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card