RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G076050
Reference: TK1151 Chr: Chr04 Coordinates: 20011754-20014255 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2385 bp · TkA04G076050|TK1151|cDNA

TAATAGATAAATTTCAACGCCAATAGTCTATTGAGCAAGAAAAATGTATAACTGATTAATTCGAGACAAACAAAACTTGTCCTCAATGAACGCACCGAATTCAAATAAAAATTAAATATCTTTCAGCTGTTGCTCCTATTTATCAAGCTACCAATTTCAAACAATAAAAATATCTTTTATCCTCTTACCCATTTAATACATTTGTCATTAAAAATAAAGGATGAACTAAAATAAAAAGATATTACAATGCTTAATTTCTC...

CDS

Download CDS FASTA

1140 bp · TkA04G076050|TK1151|CDS

ATGAATCCCACAGACCTTGAACAACTTGTAACCAGATCTCCAAATCTCACAAGGCTTACACTAAACATAACCACGACTTCCGACACCATCAGAAGGATCTTGTTAAAAGCTCCTCAACTGACGCACTTGGGTGCTGGCTCCAACAACCCGCAGTTGCAGATAAATCTCTACACTCTACTAGCATCATCATTTCACAAGTGTAAATCAATTAAAAGCCTTGCCCTCTTCCACCTTATTCCCCCTATACTTCTACGATCTAT...

Protein

Download Protein FASTA

379 aa · TkA04G076050|TK1151|PROTEIN

MNPTDLEQLVTRSPNLTRLTLNITTTSDTIRRILLKAPQLTHLGAGSNNPQLQINLYTLLASSFHKCKSIKSLALFHLIPPILLRSIYPICPNLVHLNLRCVVAGIQSLDLIRFIKNCPNLQRLSILDTIGDAGLQVVSHTCKNLQELKIYHGRTVVGVTDIGLTAISTGCQNLRSLRYLCTRMTNTALITFSKNCSSTTCFKLTMLIPKQPDHTTQQPLDDGFRAIVQSCKDLRKLTLAGLLTDQVFLYIGMYAEKLEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G076050
TK1151 IDTkA04G076050
OH-1004 IDLXL04_010138
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)40.600
Protein coverage (%)TK1151 98.681 / OH-1004 61.398
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G076050
LocationChr04:20011754-20014255 (-)
DescriptionSimilar to TIR1: Protein TRANSPORT INHIBITOR RESPONSE 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g12820 Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity). No verified direct reference in this release
At3g26810 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088
At3g62980 Auxin receptor that mediates Aux/IAA proteins proteasomal degradation and auxin-regulated transcription.
Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana.1999 · DOI: 10.1101/gad.13.13.1678
Five components of the ethylene-response pathway identified in a screen for weak ethylene-insensitive mutants in Arabidopsis.2003 · DOI: 10.1073/pnas.0438070100
The Arabidopsis F-box protein TIR1 is an auxin receptor.2005 · DOI: 10.1038/nature03542
A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088
Small-molecule agonists and antagonists of F-box protein-substrate interactions in auxin perception and signaling.2008 · DOI: 10.1073/pnas.0711146105
The TIR1 protein of Arabidopsis functions in auxin response and is related to human SKP2 and yeast grr1p.1998 · DOI: 10.1101/gad.12.2.198

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0395600 Transport inhibitor response 1-like protein Os04g0395600. No verified direct reference in this release
Os11g0515500 Transport inhibitor response 1-like protein Os11g0515500. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006952 defense response Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010152 pollen maturation Biological Process
GO:0010311 lateral root formation Biological Process
GO:0016036 cellular response to phosphate starvation Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process
GO:0045014 carbon catabolite repression of transcription by glucose Biological Process
GO:0048443 stamen development Biological Process
KEGG gene cross-reference
ath:AT1G12820
ath:AT3G26810
ath:AT3G62980
ath:AT4G03190
dosa:Os04g0395600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.591
Rank 1 · TkA04G076050 · TK1151
Cytoplasm0.324
Rank 2 · TkA04G076050 · TK1151
Mitochondrion0.071
Rank 3 · TkA04G076050 · TK1151
Cell membrane0.050
Rank 4 · TkA04G076050 · TK1151
Endoplasmic reticulum0.037
Rank 5 · TkA04G076050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29594LRR_SKP23-130 aa
PF24758LRR_At5g563704-45 aa
PF12799LRR_44-24 aa
PF28505DUF1699_N13-39 aa
PF12799LRR_414-54 aa
PF12799LRR_438-75 aa
PF13306LRR_551-151 aa
PF24758LRR_At5g5637057-148 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G076050PF29594LRR_SKP231302.1e-0731.2
TkA04G076050PF24758LRR_At5g563704453e-1040.9
TkA04G076050PF12799LRR_44240.0007820.3
TkA04G076050PF28505DUF1699_N13390.1712.3
TkA04G076050PF12799LRR_414540.0007820.3
TkA04G076050PF12799LRR_438750.0007820.3
TkA04G076050PF13306LRR_5511510.007216.9
TkA04G076050PF24758LRR_At5g56370571483e-1040.9
TkA04G076050PF12799LRR_4911010.0007820.3
TkA04G076050PF12799LRR_4921280.0007820.3
TkA04G076050PF28505DUF1699_N1081260.1712.3
TkA04G076050PF25372LRR_FBXL151151891.3e-0834.4
TkA04G076050PF13306LRR_51161790.007216.9
TkA04G076050PF12799LRR_41191500.0007820.3
TkA04G076050PF29594LRR_SKP21341992.1e-0731.2
TkA04G076050PF12799LRR_41441780.0007820.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LPW7Arabidopsis thalianasp|Q9LPW7|AFB3_ARATH Protein AUXIN SIGNALING F-BOX 348.600%Swiss-ProtMedium
Q9LW29Arabidopsis thalianasp|Q9LW29|AFB2_ARATH Protein AUXIN SIGNALING F-BOX 247.100%Swiss-ProtMedium
Q570C0Arabidopsis thalianasp|Q570C0|TIR1_ARATH Protein TRANSPORT INHIBITOR RESPONSE 142.200%Swiss-ProtMedium
Q7XVM8Oryza sativa subsp. japonicasp|Q7XVM8|TIR1B_ORYSJ Transport inhibitor response 1-like protein Os04g039560045.800%Swiss-ProtMedium
Q2R3K5Oryza sativa subsp. japonicasp|Q2R3K5|TIRC_ORYSJ Transport inhibitor response 1-like protein Os11g051550045.300%Swiss-ProtMedium

JBrowse

View in Genome Browser