TkA04G075290 | RubberDandelionOmics

Gene overview

TkA04G075290

Reference: TK1151 Chr: Chr04 Coordinates: 19869256-19870299 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

951 bp · TkA04G075290|TK1151|cDNA

ATGTTTAGCATTGAACAACTCAGAAAAGCGATTGATAATTATTCGAAGGAGCGAATTGTAGGTCAAGGTGGATATGGCGTAGTTTATAAAGGAATCTTTCCAGATAAACGGGTTGTTGCAATAAAGAAGTCTAAAGTAGTGGATAATGCCCAATCAGAGCAATTCATCAATGAAATCTGGATCCTTACACAAGTCATCCATCGAAATGTAGTTAAGGTGTTAGGTTGTTGTTTGGAAGAGGAGGTGCCAGTGCTAGTTTA...

CDS

Download CDS FASTA

951 bp · TkA04G075290|TK1151|CDS

ATGTTTAGCATTGAACAACTCAGAAAAGCGATTGATAATTATTCGAAGGAGCGAATTGTAGGTCAAGGTGGATATGGCGTAGTTTATAAAGGAATCTTTCCAGATAAACGGGTTGTTGCAATAAAGAAGTCTAAAGTAGTGGATAATGCCCAATCAGAGCAATTCATCAATGAAATCTGGATCCTTACACAAGTCATCCATCGAAATGTAGTTAAGGTGTTAGGTTGTTGTTTGGAAGAGGAGGTGCCAGTGCTAGTTTA...

Protein

Download Protein FASTA

316 aa · TkA04G075290|TK1151|PROTEIN

MFSIEQLRKAIDNYSKERIVGQGGYGVVYKGIFPDKRVVAIKKSKVVDNAQSEQFINEIWILTQVIHRNVVKVLGCCLEEEVPVLVYEFISNNTLFYHLHNKPGGMSWLSWENRLRIAAETASALAYLHSQATMPTIHRDVKSANILLDENYTTKISDFGASRLVPLDHDQVTTLVQGTLGLKPLCVSRTNLEKNLATYFVKSMKENRTFQIIDPRVLQEGSIEQLQAVAELVKRCLNLLGEDRPTMKEVAMELEGLRKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G075290`
TK1151 ID	TkA04G075290
OH-1004 ID	LXL04_036098
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.500
Protein coverage (%)	TK1151 100.000 / OH-1004 46.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G075290

Location Chr04:19869256-19870299 (+)

Description Similar to WAK2: Wall-associated receptor kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21240`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21230`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g21210`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317
`At1g21250`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	Oxygen-evolving enhancer protein 2 is phosphorylated by glycine-rich protein 3/wall-associated kinase 1 in Arabidopsis.2003 · DOI: 10.1016/s0006-291x(03)00851-9 Aluminum-induced gene expression and protein localization of a cell wall-associated receptor kinase in Arabidopsis.2003 · DOI: 10.1104/pp.103.022129
`At3g25490`	Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036098 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0009615 response to virus Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009992 intracellular water homeostasis Biological Process

GO:0048527 lateral root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G21210

ath:AT1G21230

ath:AT1G21240

ath:AT1G21250

ath:AT1G21270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532

Rank 1 · TkA04G075290 · TK1151

Cytoplasm0.391

Rank 2 · TkA04G075290 · TK1151

Nucleus0.262

Rank 3 · TkA04G075290 · TK1151

Golgi apparatus0.041

Rank 4 · TkA04G075290 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA04G075290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase14-176 aa

PF07714PK_Tyr_Ser-Thr17-168 aa

PF12330Haspin_kinase46-76 aa

PF12330Haspin_kinase110-168 aa

PF07714PK_Tyr_Ser-Thr209-254 aa

PF00069Pkinase224-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G075290	`PF00069`	Pkinase	14	176	7.8e-33	114.7
TkA04G075290	`PF07714`	PK_Tyr_Ser-Thr	17	168	8.8e-33	114.4
TkA04G075290	`PF12330`	Haspin_kinase	46	76	0.12	12.1
TkA04G075290	`PF12330`	Haspin_kinase	110	168	0.12	12.1
TkA04G075290	`PF07714`	PK_Tyr_Ser-Thr	209	254	8.8e-33	114.4
TkA04G075290	`PF00069`	Pkinase	224	250	7.8e-33	114.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMN8`	Arabidopsis thaliana	sp\|Q9LMN8\|WAK3_ARATH Wall-associated receptor kinase 3	49.000%	Swiss-Prot	Medium
`Q9LMN7`	Arabidopsis thaliana	sp\|Q9LMN7\|WAK5_ARATH Wall-associated receptor kinase 5	50.300%	Swiss-Prot	High
`Q9LMN6`	Arabidopsis thaliana	sp\|Q9LMN6\|WAK4_ARATH Wall-associated receptor kinase 4	50.200%	Swiss-Prot	High
`Q39191`	Arabidopsis thaliana	sp\|Q39191\|WAK1_ARATH Wall-associated receptor kinase 1	48.400%	Swiss-Prot	Medium
`Q9LSV3`	Arabidopsis thaliana	sp\|Q9LSV3\|WAKLS_ARATH Putative wall-associated receptor kinase-like 16	48.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card