Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2859 bp · TkA04G074040|TK1151|cDNA
CTGGAAATAGGCAAGATACAAAGTTTTGATTGCATACGAAAGTGGATTACTAATTCTCTGGGACGTATTTGAATCTCAAGTTATTGTAGTCAGAGGTGATAACGATCTTGAACTGAAGAACAACGAAGTCGTTGACTCAATTAGTCAACCCGAACCCAATTCGGAGGAAAAAGAGATAACCGCTCTTTGCTGGGCATCTTCAAATGGCAGCATTCTCGCCGTCGGATACATCGATGGAGACATCATGTTTTGGAAACATC...
1746 bp · TkA04G074040|TK1151|CDS
ATGGGATGCCACGTCACCAGTCTTATCACTTCTTTGCATTATAGGAGAGATGAAAGATGTGGAAGGGAAGGGGTCAACTGCTCCAGTTTCAGAACTGAACTTTTGCTCATTGACTTCAGTTTAGCAGTTGGAAATCAAGTTGGTTTGGTAAGAATATATAACCTCAATTCCAGTTTGAAAGATTCAAGCCTTCATATTGTCACAGCAATAAAACAAGAAGTTCAAAAACAAGGGGAAGGTGGTGGGCCCAAGTGTAGTGC...
Protein
Download Protein FASTA581 aa · TkA04G074040|TK1151|PROTEIN
MGCHVTSLITSLHYRRDERCGREGVNCSSFRTELLLIDFSLAVGNQVGLVRIYNLNSSLKDSSLHIVTAIKQEVQKQGEGGGPKCSACFHLLDSPVQSLQYTDHGSKLSVAYECGRVAVFDMKLFSVLFLSDPLPNPRTPVVSMIWKSLSYNDNQVKSPKDSGPKNLEKTIESLLFVLTKDAKLYLFNGDNHHMINSKPMQLKKETTAISMHVIDGSSSTTTTSMVDSVDQKESKQLTKDDVTAKNEVDQKDSLVLLCCK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G074040 |
|---|---|
| TK1151 ID | TkA04G074040 |
| OH-1004 ID | LXL04_036116 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.600 |
| Protein coverage (%) | TK1151 93.115 / OH-1004 46.713Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G074040 |
|---|---|
| Location | Chr04:19513367-19520210 (-) |
| Description | Similar to STXBP5L: Syntaxin-binding protein 5-like |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006887 exocytosis Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0015031 protein transport Biological Process GO:0017157 regulation of exocytosis Biological Process GO:0042593 glucose homeostasis Biological Process GO:0045921 positive regulation of exocytosis Biological Process GO:0050714 positive regulation of protein secretion Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005892 acetylcholine-gated channel complex Cellular Component GO:0030141 secretory granule Cellular Component |
| KEGG gene cross-reference | hsa:134957 hsa:9515 mmu:207227 rno:81022 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23098Beta-prop_NOL10_N20-132 aaPF12894ANAPC4_WD4041-57 aaPF12894ANAPC4_WD4093-124 aaPF08596Lgl_C106-122 aaPF12894ANAPC4_WD40172-203 aaPF23098Beta-prop_NOL10_N183-245 aaPF08614ATG16202-273 aaPF31021RBSN_mid223-240 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G074040 | PF23098 | Beta-prop_NOL10_N | 20 | 132 | 0.028 | 14.3 |
| TkA04G074040 | PF12894 | ANAPC4_WD40 | 41 | 57 | 0.031 | 15.2 |
| TkA04G074040 | PF12894 | ANAPC4_WD40 | 93 | 124 | 0.031 | 15.2 |
| TkA04G074040 | PF08596 | Lgl_C | 106 | 122 | 0.00066 | 19.2 |
| TkA04G074040 | PF12894 | ANAPC4_WD40 | 172 | 203 | 0.031 | 15.2 |
| TkA04G074040 | PF23098 | Beta-prop_NOL10_N | 183 | 245 | 0.028 | 14.3 |
| TkA04G074040 | PF08614 | ATG16 | 202 | 273 | 1.1 | 10.1 |
| TkA04G074040 | PF31021 | RBSN_mid | 223 | 240 | 1.1 | 10.7 |
| TkA04G074040 | PF12894 | ANAPC4_WD40 | 250 | 324 | 0.031 | 15.2 |
| TkA04G074040 | PF08596 | Lgl_C | 276 | 373 | 0.00066 | 19.2 |
| TkA04G074040 | PF12894 | ANAPC4_WD40 | 331 | 365 | 0.031 | 15.2 |
| TkA04G074040 | PF08614 | ATG16 | 482 | 564 | 1.1 | 10.1 |
| TkA04G074040 | PF31021 | RBSN_mid | 529 | 564 | 1.1 | 10.7 |
| TkA04G074040 | PF00957 | Synaptobrevin | 536 | 577 | 4e-06 | 27.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.