TkA04G073810 | RubberDandelionOmics

Gene overview

TkA04G073810

Reference: TK1151 Chr: Chr04 Coordinates: 19479339-19481622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · TkA04G073810|TK1151|cDNA

GTTTTATAATGTAAAAGGTCATTGGGTCTTCCTATTTGACCATTTTGGCCACGTATAAAGCTTTCCACCATTCTCATCTCATCTCTCTTTCAAACAATACGCAGGAAAGATCTTTTTCTTCCTTCCCAATCCATCTACCAAACTACCAACATATTTTTCTTTAAAAGAAATCTTTTTTGCATCTATAAAATATACATGGATCCTAGTCACCTTCATCATATGAGTGTAAGTGTGGATTCCGGTGGCCCCAGTGGTAGTGG...

CDS

Download CDS FASTA

843 bp · TkA04G073810|TK1151|CDS

ATGGATCCTAGTCACCTTCATCATATGAGTGTAAGTGTGGATTCCGGTGGCCCCAGTGGTAGTGGTGGTGGTGGTGGTGGCGGCGGTGATAGGTTTCCACAATGGAGCGTACAAGAAACAAGGGATTTCTTGATGATAAGAGCGGAGCTGGATCCGACGTTCATGGAGACAAAACGTAATAAGCTTCTTTGGGAAGTTATCTCTACGAAGATGAAGGAGAGGGGGTATAATCGAAGCGCTGAGCAGTGCAAATGCAAATG...

Protein

Download Protein FASTA

280 aa · TkA04G073810|TK1151|PROTEIN

MDPSHLHHMSVSVDSGGPSGSGGGGGGGGDRFPQWSVQETRDFLMIRAELDPTFMETKRNKLLWEVISTKMKERGYNRSAEQCKCKWKNLVTRYKGLETMEQEGTRQHFPFYNELQMIFTNRMQRMLWMEAEGMQAGGSSKKRSVMHLSSEDEDDNDESDVEKVIGVNNKKKKKISNTTTSKGNPDSIMMNLKEILEDLMKQQMQIEMQWMKSYEAKEEERRMKEMEWRQTMEALEKERIMFDRRWQEREEQRRIREENR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G073810`
TK1151 ID	TkA04G073810
OH-1004 ID	LXL04_019151
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	64.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G073810

Location Chr04:19479339-19481622 (+)

Description Similar to GT-3B: Trihelix transcription factor GT-3b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38250`	Probable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt.	Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor.2004 · DOI: 10.1104/pp.104.041442
`At5g01380`	Probable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'.	Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis.2004 · DOI: 10.1016/s0014-5793(04)00222-4
`At3g25990`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release
`At1g13450`	Probable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019151 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G13450

ath:AT1G76890

ath:AT2G38250

ath:AT3G25990

ath:AT5G01380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.983

Rank 1 · TkA04G073810 · TK1151

Cytoplasm0.057

Rank 2 · TkA04G073810 · TK1151

Cell membrane0.021

Rank 3 · TkA04G073810 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA04G073810 · TK1151

Plastid0.009

Rank 5 · TkA04G073810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_434-117 aa

PF00249Myb_DNA-binding35-90 aa

PF10545MADF_DNA_bdg52-116 aa

PF30133OSW2_M141-186 aa

PF09451ATG27153-229 aa

PF30133OSW2_M188-234 aa

PF10545MADF_DNA_bdg202-212 aa

PF13837Myb_DNA-bind_4210-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G073810	`PF13837`	Myb_DNA-bind_4	34	117	2.3e-22	79.9
TkA04G073810	`PF00249`	Myb_DNA-binding	35	90	0.025	15.4
TkA04G073810	`PF10545`	MADF_DNA_bdg	52	116	0.00019	22.4
TkA04G073810	`PF30133`	OSW2_M	141	186	0.25	11.9
TkA04G073810	`PF09451`	ATG27	153	229	0.81	10.2
TkA04G073810	`PF30133`	OSW2_M	188	234	0.25	11.9
TkA04G073810	`PF10545`	MADF_DNA_bdg	202	212	0.00019	22.4
TkA04G073810	`PF13837`	Myb_DNA-bind_4	210	222	2.3e-22	79.9
TkA04G073810	`PF13837`	Myb_DNA-bind_4	220	238	2.3e-22	79.9
TkA04G073810	`PF10545`	MADF_DNA_bdg	220	260	0.00019	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80450`	Arabidopsis thaliana	sp\|O80450\|TGT3B_ARATH Trihelix transcription factor GT-3b	52.200%	Swiss-Prot	High
`Q9SDW0`	Arabidopsis thaliana	sp\|Q9SDW0\|TGT3A_ARATH Trihelix transcription factor GT-3a	48.900%	Swiss-Prot	Medium
`Q9LU92`	Arabidopsis thaliana	sp\|Q9LU92\|TGT4_ARATH Trihelix transcription factor GT-4	33.600%	Swiss-Prot	Low
`Q9FX53`	Arabidopsis thaliana	sp\|Q9FX53\|TGT1_ARATH Trihelix transcription factor GT-1	32.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card