RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G072550
Reference: TK1151 Chr: Chr04 Coordinates: 19195003-19197621 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1616 bp · TkA04G072550|TK1151|cDNA

TGTGATTACTAAAAACGTTAGGGGTGGTGAGGAAATATAAATCAAAATAAAAGCCCCCTTTCATTCTCGTTTTTCTCTCAACTGTCTCTCCGTGTTCAACTCGCGTTTCAGCAATAACATTTGAGAGAGAATTTTCTACACCAGCAGCCATTCCCGAAATCGAAGTCGTAATATATTTTACTTTTAAAATTTGCCACTGTCCTGATATTGGATCTTACTCCAATCGCAATTTCCAATTTTGTATTTCGTTGAAAAATCTC...

CDS

Download CDS FASTA

948 bp · TkA04G072550|TK1151|CDS

ATGGCATTGCTCTTACACGATCAAACAATGTCGCTTTACATTGGTCGCGAGACTTCCAAGCTGTGGAAAAGAATTAGTGCAGAAACTATAACTGAAGTCAACCTTCTAGCGGAGAACTGGAAGTATATTCTCGGCGGTTTAACTTGCCAGTACATTCATGGGCTGGCTGCTCGAGGTGTTCACTACATTCATCGCCCTGGTCCAATTCTACAAGACACTGGATTCCGTCTACTTCCAGAGCTTGGACAGGAGAGAGCGTA...

Protein

Download Protein FASTA

315 aa · TkA04G072550|TK1151|PROTEIN

MALLLHDQTMSLYIGRETSKLWKRISAETITEVNLLAENWKYILGGLTCQYIHGLAARGVHYIHRPGPILQDTGFRLLPELGQERAYVSETVFTFVFLSFVLWSLHPFILKTKKIYTILIWCRVLAFLSACQFLRILTFYSTQLPGPNYHCREGSRFATLPRPDNPLEFLLIMPRGVLYGCGDLIFSSHMIFSLVFVRTYQKYGTRRFIKQCAWLTVVIQSLLIIASRKHYTVDVVVAWYTVNLVVFFLDRKLAEMPERN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G072550
TK1151 IDTkA04G072550
OH-1004 IDLXL04_036136
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G072550
LocationChr04:19195003-19197621 (-)
DescriptionSimilar to IPCS2: Phosphatidylinositol:ceramide inositolphosphotransferase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g37940 Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis.
An inositolphosphorylceramide synthase is involved in regulation of plant programmed cell death associated with defense in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060053
At3g54020 Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. No verified direct reference in this release
At2g29525 Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8ACH9 Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. No verified direct reference in this release
Os01g0850100 Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036136 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0030148 sphingolipid biosynthetic process Biological Process
GO:0046513 ceramide biosynthetic process Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0033188 sphingomyelin synthase activity Molecular Function
GO:0045140 inositol phosphoceramide synthase activity Molecular Function
GO:0047493 ceramide cholinephosphotransferase activity Molecular Function
KEGG gene cross-reference
ath:AT2G29525
ath:AT2G37940
ath:AT3G54020
dosa:Os01g0850100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.473
Rank 1 · TkA04G072550 · TK1151
Golgi apparatus0.342
Rank 2 · TkA04G072550 · TK1151
Cytoplasm0.095
Rank 3 · TkA04G072550 · TK1151
Cell membrane0.078
Rank 4 · TkA04G072550 · TK1151
Nucleus0.078
Rank 5 · TkA04G072550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01569PAP286-127 aa
PF14378PAP2_394-128 aa
PF14360PAP2_C95-123 aa
PF01569PAP2161-240 aa
PF14360PAP2_C180-248 aa
PF24788AtPDCT1_2184-238 aa
PF14378PAP2_3187-244 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G072550PF01569PAP2861270.08513.3
TkA04G072550PF14378PAP2_3941280.0007320.0
TkA04G072550PF14360PAP2_C951234.5e-2382.3
TkA04G072550PF01569PAP21612400.08513.3
TkA04G072550PF14360PAP2_C1802484.5e-2382.3
TkA04G072550PF24788AtPDCT1_21842380.02315.2
TkA04G072550PF14378PAP2_31872440.0007320.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SH93Arabidopsis thalianasp|Q9SH93|IPCS2_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 272.400%Swiss-ProtHigh
Q9M325Arabidopsis thalianasp|Q9M325|IPCS1_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 172.000%Swiss-ProtHigh
Q56Y01Arabidopsis thalianasp|Q56Y01|IPCS3_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 364.700%Swiss-ProtHigh
B8ACH9Oryza sativa subsp. indicasp|B8ACH9|IPCS_ORYSI Phosphatidylinositol:ceramide inositolphosphotransferase64.800%Swiss-ProtHigh
Q5N7A7Oryza sativa subsp. japonicasp|Q5N7A7|IPCS_ORYSJ Phosphatidylinositol:ceramide inositolphosphotransferase64.800%Swiss-ProtHigh

JBrowse

View in Genome Browser