TkA04G068410 | RubberDandelionOmics

Gene overview

TkA04G068410

Reference: TK1151 Chr: Chr04 Coordinates: 18143154-18145451 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · TkA04G068410|TK1151|cDNA

ATAAATCCATCCTTCACCCAATTTACACCACTTCGGTATTCTCGGAAGTGACGTTCCGAATACACGCTACTTATATTCTCTCTTCACCTTCAAACCTGCTAAAGAAGTAGAAACAAATCTCGATCGATCAATAATGGCCGGAACTGCTTCATCTGCTAAAAGATGGCTTCCGCTCGAAGCCAACCCTGATGTTATGAACCAGTTTCTTTGGCGTCTTGGTGTTGTTCCTGGTGAGGCTGAATGCAGTGATGTATATGGAT...

CDS

Download CDS FASTA

702 bp · TkA04G068410|TK1151|CDS

ATGGCCGGAACTGCTTCATCTGCTAAAAGATGGCTTCCGCTCGAAGCCAACCCTGATGTTATGAACCAGTTTCTTTGGCGTCTTGGTGTTGTTCCTGGTGAGGCTGAATGCAGTGATGTATATGGATTGGATGAAGAACTCTTGGCAATGGTCCCACAGCCAGTTCTTGCTGTGTTGTTTCTTTACCCAATCACACCACAGAGTGAAGAAGAAAGATTAAAGCAGAACGATATCAAACAGGGTCCTTCTGATGGGGTTTA...

Protein

Download Protein FASTA

233 aa · TkA04G068410|TK1151|PROTEIN

MAGTASSAKRWLPLEANPDVMNQFLWRLGVVPGEAECSDVYGLDEELLAMVPQPVLAVLFLYPITPQSEEERLKQNDIKQGPSDGVYFMRQTVGNACGTVGLLHAVGNLTSEIKLDEGSFLEKFFKTTANMEPMEIARYLEKDTEMEVAHSEAVAAGETEANDNVNDHFICFVCVNGQLYELDGRRNAPLSHGPSSPNTVLQDAAKVIKGMIAKNPDSMNFSVIAISKKVGDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G068410`
TK1151 ID	TkA04G068410
OH-1004 ID	LXL04_036190
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G068410

Location Chr04:18143154-18145451 (+)

Description Similar to UCH3: Ubiquitin carboxyl-terminal hydrolase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17510`	Ubiquitin carboxyl-terminal hydrolase 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036190 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0032869 cellular response to insulin stimulus Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

GO:0019784 deNEDDylase activity Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT4G17510

bta:520170

hsa:7347

rno:498560

ssc:768115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · TkA04G068410 · TK1151

Nucleus0.493

Rank 2 · TkA04G068410 · TK1151

Mitochondrion0.105

Rank 3 · TkA04G068410 · TK1151

Cell membrane0.070

Rank 4 · TkA04G068410 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA04G068410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01088Peptidase_C1211-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G068410	`PF01088`	Peptidase_C12	11	212	8.9e-67	225.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWE1`	Arabidopsis thaliana	sp\|Q8GWE1\|UCH3_ARATH Ubiquitin carboxyl-terminal hydrolase 3	67.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card