Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1717 bp · TkA04G067610|TK1151|cDNA
GCAAAATGGAAAACAGAGGTTTGCGTGCTCTCCCTCTTCAGTGAATCACCGGCCCTTGCCCCTCCGTGAGCGGCGACTTACGACTAGTAACCACTGACAATTCTATAGCCGCGTGAGACTAGAGGAGGCGGTGGGACATCTGTTGTGGTACTGGTGGTAGTCTGTTGCTCTTATCTTTTCTACACTTCTTAATACATGCTGCGAAATACTGAACACTTGGCAATTGGCACACAAATTGGATTTGTTCTCTCATCCTCAAG...
1230 bp · TkA04G067610|TK1151|CDS
ATGCGTTCAAAAATGTCTTTCTTAATCAAGTCTATTGGATTTAACAATGTCCTCCGACCGAATCCCCTTTTCAATCTCTTTTCCTCCTGCAAACAACAACAGAATCGTCGGAGAGGAAGAATCAACTGGACTGAGATAAGCCGGTGTTATTTTTCATCAACAGTTGAAGCTTCAGACCTAGACCTAGAAGATGATAAACTTCACGATGATACTAAAGCTGCAGAAAAGCATACAGCTCTTCATTCAGCCCTATCAGAACT...
Protein
Download Protein FASTA409 aa · TkA04G067610|TK1151|PROTEIN
MRSKMSFLIKSIGFNNVLRPNPLFNLFSSCKQQQNRRRGRINWTEISRCYFSSTVEASDLDLEDDKLHDDTKAAEKHTALHSALSELAGDFDGESMLFLQRFFGTRVKPVVSTGSLKLDLALGIGGLPKGRIVEVYGHEGSGKTTLALNVIKEAQKLGGYCAYMDVENALDPLLLETVGVDTKNLLISQPNSAENLLSIVDTLTQSGAVDVIVIDSVAALIPQREITGVISDNFVETQSRIMTRALRKIHYSLCRSDTLI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G067610 |
|---|---|
| TK1151 ID | TkA04G067610 |
| OH-1004 ID | LXL04_036180 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G067610 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:17941215-17943594 (+) | |||||||||
| Description | Similar to At3g10140: DNA repair protein recA homolog 2, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0009408 response to heat Biological Process GO:0009432 SOS response Biological Process GO:1905951 mitochondrion DNA recombination Biological Process GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0003684 damaged DNA binding Molecular Function GO:0003697 single-stranded DNA binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0140664 ATP-dependent DNA damage sensor activity Molecular Function | |||||||||
| KEGG gene cross-reference | acr:Acry_1034 ath:AT2G19490 ath:AT3G10140 avi:Avi_2558 lhk:LHK_00793 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00931NB-ARC40-83 aaPF13191AAA_1664-88 aaPF00154RecA_N79-343 aaPF13173AAA_1499-134 aaPF06745ATPase111-268 aaPF08423Rad51111-303 aaPF03796DnaB_C111-210 aaPF13481AAA_25125-150 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G067610 | PF00931 | NB-ARC | 40 | 83 | 0.0035 | 17.6 |
| TkA04G067610 | PF13191 | AAA_16 | 64 | 88 | 0.0016 | 19.7 |
| TkA04G067610 | PF00154 | RecA_N | 79 | 343 | 7.8e-86 | 288.5 |
| TkA04G067610 | PF13173 | AAA_14 | 99 | 134 | 0.051 | 14.3 |
| TkA04G067610 | PF06745 | ATPase | 111 | 268 | 8.1e-08 | 32.6 |
| TkA04G067610 | PF08423 | Rad51 | 111 | 303 | 3.6e-07 | 30.4 |
| TkA04G067610 | PF03796 | DnaB_C | 111 | 210 | 0.023 | 14.8 |
| TkA04G067610 | PF13481 | AAA_25 | 125 | 150 | 0.00017 | 22.0 |
| TkA04G067610 | PF27531 | MT3502_N | 125 | 223 | 0.011 | 16.7 |
| TkA04G067610 | PF00005 | ABC_tran | 127 | 159 | 0.018 | 16.3 |
| TkA04G067610 | PF13191 | AAA_16 | 129 | 222 | 0.0016 | 19.7 |
| TkA04G067610 | PF25199 | nSTAND_NTPase5 | 129 | 212 | 0.076 | 13.6 |
| TkA04G067610 | PF20720 | nSTAND3 | 129 | 159 | 0.13 | 12.6 |
| TkA04G067610 | PF13401 | AAA_22 | 131 | 223 | 7.6e-05 | 23.7 |
| TkA04G067610 | PF01637 | ATPase_2 | 131 | 178 | 0.00019 | 22.0 |
| TkA04G067610 | PF24883 | NPHP3_N | 131 | 164 | 0.011 | 16.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.