RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G067490
Reference: TK1151 Chr: Chr04 Coordinates: 17906861-17910062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2248 bp · TkA04G067490|TK1151|cDNA

AAAAGCCCAAATTCAATGAACCCCGTTATGTCGGTTTACCGTTTACGTTCGCACCCTGTCCCTGTTCCCACCAAAAGGGTATCGCCTCTATAACTAACACATACACCAATCATAAGCCATCCTAAAACCAAAATCGCTATGGGTTTAGAGATCATACATCCTAATTCTTGCATCAGAGGGTGTTGCCGGAGCGATTCCATCCCTCTGCACCTCCCGTCGTCTTCCTACTCACTCTTACTTCCAATTGCTCGAGGTGCTGA...

CDS

Download CDS FASTA

1932 bp · TkA04G067490|TK1151|CDS

ATGGGTTTAGAGATCATACATCCTAATTCTTGCATCAGAGGGTGTTGCCGGAGCGATTCCATCCCTCTGCACCTCCCGTCGTCTTCCTACTCACTCTTACTTCCAATTGCTCGAGGTGCTGAAAGCGTTGTTTATGATGCAATATTGGATGGAGAAAGAGTCGCTGTTAAAAAGCCCGTTTTGTCCACCTCCGACGACATCAATAAGTTCCATAAGGAATTGCAATTGCTGTGCAAGTTGAATCATCAAGGGATCGCGAC...

Protein

Download Protein FASTA

643 aa · TkA04G067490|TK1151|PROTEIN

MGLEIIHPNSCIRGCCRSDSIPLHLPSSSYSLLLPIARGAESVVYDAILDGERVAVKKPVLSTSDDINKFHKELQLLCKLNHQGIATLLAAHARPPNYMFFFKFYEFGNLSQKLHVEEWNPSINQALMIIKQLANSLQYLHNIGVVHRDVKPANVLLDKNLRPHLADFGLSEYKQDLKQVTLQNWRSSGKPTGGFHKKNMVGTLIYMPPEVLKKEIHTEKSDVYSFAITINELLTGVVPYTDLRTEAQAHTVLEMNYTEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G067490
TK1151 IDTkA04G067490
OH-1004 IDLXL04_002768
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)33.000
Protein coverage (%)TK1151 44.635 / OH-1004 84.986
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G067490
LocationChr04:17906861-17910062 (+)
DescriptionSimilar to Os02g0799000: Probable protein phosphatase 2C 27
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
UniProt: Q940A2 Protein kinase and PP2C-like domain-containing protein. No verified direct reference in this release
At4g31750 Protein phosphatase that modulates defense response to pathogenic bacteria, conferring resistance and promoting salicylic acid (SA) accumulation.
Arabidopsis proteins important for modulating defense responses to Pseudomonas syringae that secrete HopW1-1.2008 · DOI: 10.1111/j.1365-313x.2008.03439.x

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0541900 Protein kinase and PP2C-like domain-containing protein. No verified direct reference in this release
Os02g0149800 Probable protein phosphatase 2C 10. No verified direct reference in this release
Os06g0698300 Probable protein phosphatase 2C 59. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002768 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0050688 regulation of defense response to virus Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004722 protein serine/threonine phosphatase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT2G25620
ath:AT2G33700
dosa:Os02g0799000
dosa:Os06g0179700
dosa:Os06g0597200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.452
Rank 1 · TkA04G067490 · TK1151
Cell membrane0.295
Rank 2 · TkA04G067490 · TK1151
Nucleus0.277
Rank 3 · TkA04G067490 · TK1151
Golgi apparatus0.092
Rank 4 · TkA04G067490 · TK1151
Endoplasmic reticulum0.082
Rank 5 · TkA04G067490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01636APH35-80 aa
PF00069Pkinase36-309 aa
PF07714PK_Tyr_Ser-Thr36-311 aa
PF03109ABC143-57 aa
PF06293Kdo118-163 aa
PF01636APH122-160 aa
PF17667Pkinase_fungal125-226 aa
PF14531Kinase-like126-169 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G067490PF01636APH35800.002718.2
TkA04G067490PF00069Pkinase363092.1e-41142.8
TkA04G067490PF07714PK_Tyr_Ser-Thr363113.5e-40138.7
TkA04G067490PF03109ABC143570.007116.2
TkA04G067490PF06293Kdo1181630.002418.1
TkA04G067490PF01636APH1221600.002718.2
TkA04G067490PF17667Pkinase_fungal1252260.006116.0
TkA04G067490PF14531Kinase-like1261690.03913.9
TkA04G067490PF03109ABC11361800.007116.2
TkA04G067490PF03109ABC12222580.007116.2
TkA04G067490PF02768DNA_pol3_beta_33033540.2411.9
TkA04G067490PF00481PP2C3816262.2e-60205.2
TkA04G067490PF06293Kdo5155510.002418.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q940A2Arabidopsis thalianasp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein64.500%Swiss-ProtHigh
Q8RXV3Arabidopsis thalianasp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 5941.100%Swiss-ProtMedium
Q5JJY4Oryza sativa subsp. japonicasp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein65.300%Swiss-ProtHigh
Q67UX7Oryza sativa subsp. japonicasp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 1040.600%Swiss-ProtMedium
Q5Z6F5Oryza sativa subsp. japonicasp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 5939.500%Swiss-ProtMedium

JBrowse

View in Genome Browser