TkA04G067480 | RubberDandelionOmics

Gene overview

TkA04G067480

Reference: TK1151 Chr: Chr04 Coordinates: 17900958-17904347 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2007 bp · TkA04G067480|TK1151|cDNA

GAAAACTGAAAGTAAATGTTGTTTCTTAGAAAGATGCTCCCTTTTACTGCTTCCCTTTACGTTGCCTTGCGTTTGTCTCAACTCTCACCTGCCCAAACGGAATATATGATATATCTTCCATTTCTATCCCCATCGATTGAATAATTATATAAATCCCTTTTCAAGAAAAGGGCAAATAAATCTCCGATAATTATAACAATATTTTCTTGATCATCGATTTCGGATTCTGCAATATCTCTTTATCATTTCTTGCATAAACC...

CDS

Download CDS FASTA

1242 bp · TkA04G067480|TK1151|CDS

ATGGCAGCTTCGAAATCTGCTGCACGTATGGATTACTGGAGGGAGTTTTTTAAGAGCTCAAATGGCGATATATTTGAAACAATCGAGAAAGCAATCGTCGTTGCTGCTTCTGATTACTCAAACGAGTTTCGAATCAGGAGAGACGGCATTGCTGAAACTTTGTTCTCTTGTAAATTAATCAAGTGTTCTGGATGCGATAAGGTGGAATTAGGTTTGCCTGAAGACGATGAACCTCAAGAGCTTAATGTAGGTAACCATCA...

Protein

Download Protein FASTA

413 aa · TkA04G067480|TK1151|PROTEIN

MAASKSAARMDYWREFFKSSNGDIFETIEKAIVVAASDYSNEFRIRRDGIAETLFSCKLIKCSGCDKVELGLPEDDEPQELNVGNHQINNYDYGVAEALNDEIEEESLIFGEVMRIKEIVDNNRDESESVLYNSLRKLQLMNLSVETLKATEIGKSVNFIRKHASRDVSEIAKILIEAWKVMVDEWVVAVEKPAVVSEATPESLNPSVVDEEEEEEVGLPSPPLDDLAFIYPNGSLELSQFFDGMDDYGISDPRNSAGFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G067480`
TK1151 ID	TkA04G067480
OH-1004 ID	LXL04_000220
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.100
Protein coverage (%)	TK1151 99.516 / OH-1004 98.536 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G067480

Location Chr04:17900958-17904347 (-)

Description Similar to MED26B: Probable mediator of RNA polymerase II transcription subunit 26b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05140`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At3g10820`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release
`At5g09850`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000220 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G10820

ath:AT5G05140

ath:AT5G09850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.654

Rank 1 · TkA04G067480 · TK1151

Cytoplasm0.357

Rank 2 · TkA04G067480 · TK1151

Cell membrane0.098

Rank 3 · TkA04G067480 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA04G067480 · TK1151

Plastid0.026

Rank 5 · TkA04G067480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26219DUF804665-110 aa

PF03564DUF175995-118 aa

PF08711Med26134-183 aa

PF26219DUF8046185-221 aa

PF03564DUF1759348-398 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G067480	`PF26219`	DUF8046	65	110	0.066	13.8
TkA04G067480	`PF03564`	DUF1759	95	118	0.1	13.3
TkA04G067480	`PF08711`	Med26	134	183	2.1e-13	50.6
TkA04G067480	`PF26219`	DUF8046	185	221	0.066	13.8
TkA04G067480	`PF03564`	DUF1759	348	398	0.1	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHK9`	Arabidopsis thaliana	sp\|Q9FHK9\|MD26B_ARATH Probable mediator of RNA polymerase II transcription subunit 26b	39.400%	Swiss-Prot	Medium
`F4J4Y5`	Arabidopsis thaliana	sp\|F4J4Y5\|MD26A_ARATH Probable mediator of RNA polymerase II transcription subunit 26a	39.400%	Swiss-Prot	Medium
`F4KFC7`	Arabidopsis thaliana	sp\|F4KFC7\|MD26C_ARATH Probable mediator of RNA polymerase II transcription subunit 26c	63.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card