Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1490 bp · TkA04G064390|TK1151|cDNA
AGACTACTCCCCCTTACCAAATTGCTGGCTTGTGACACAAGTGAAGCCCTAACCTACCAATTCCTTCTCGCTACAATCCTTCCGAATAATTCCCCAGTAAACCATAGTCGTCATCTAGATCGGTACAGTAGAACAAAGATTCGAATATACAAAAGGCCCTCTCAAGATTGAAGGTCGTTGGTTCACTTAAAGGAAGATGAACGGCGGCCCATCTGGTTTCAATAATGCTCCGATCACTAGAACCTTTGTCATTACATGCT...
870 bp · TkA04G064390|TK1151|CDS
ATGAACGGCGGCCCATCTGGTTTCAATAATGCTCCGATCACTAGAACCTTTGTCATTACATGCTGTCTGTTCACGATCCTGTTTGGGATCCAAGGCCGTTCAAACAAGCTCGGATTGTCTTATCAGGACATCTGGAAGAAGCTTCAGTTATGGAAACTGATTGTTTCATTCTTTACATTTTCATCAACACCAGAGCTCATGTTTGGTGCATATCTCCTATACTACTTTCGTGTCTTTGAGAGACAAATAGGTTCCAACAA...
Protein
Download Protein FASTA289 aa · TkA04G064390|TK1151|PROTEIN
MNGGPSGFNNAPITRTFVITCCLFTILFGIQGRSNKLGLSYQDIWKKLQLWKLIVSFFTFSSTPELMFGAYLLYYFRVFERQIGSNKYSVFVSFSLIMSSLLQLFGQTFFNDPALSLLTSGPYGLIFSSFVPFYFDIPVSTRFRVSTLSFSDKIFIYLAGLQLLFSSWKRSLIPGLCGILAGTLYRLNVLGIRRLKFPEFIASFFSRLSFPSVGSTSLAPPPRNRPSFAPRQVEGNYRAPVPSVPEPPEDFIETLVSMGF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G064390 |
|---|---|
| TK1151 ID | TkA04G064390 |
| OH-1004 ID | LXL04_036198 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G064390 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:17153134-17155924 (-) | |||||||||
| Description | Similar to RBL20: Rhomboid-like protein 20 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0010286 heat acclimation Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0050832 defense response to fungus Biological Process GO:0070972 protein localization to endoplasmic reticulum Biological Process GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process GO:1904153 negative regulation of retrograde protein transport, ER to cytosol Biological Process GO:0005776 autophagosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0061908 phagophore Cellular Component GO:0004252 serine-type endopeptidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G41160 ath:AT3G56740 gga:418778 hsa:337867 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04511DER112-106 aaPF08551DUF175118-134 aaPF01694Rhomboid49-187 aaPF22562UBA_7249-287 aaPF09288UBA_3250-265 aaPF00627UBA252-283 aaPF28526UBA_TNK1-sid3252-283 aaPF02845CUE260-285 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G064390 | PF04511 | DER1 | 12 | 106 | 0.0082 | 16.8 |
| TkA04G064390 | PF08551 | DUF1751 | 18 | 134 | 0.002 | 18.2 |
| TkA04G064390 | PF01694 | Rhomboid | 49 | 187 | 3.8e-07 | 31.1 |
| TkA04G064390 | PF22562 | UBA_7 | 249 | 287 | 3.1e-08 | 34.1 |
| TkA04G064390 | PF09288 | UBA_3 | 250 | 265 | 0.27 | 11.8 |
| TkA04G064390 | PF00627 | UBA | 252 | 283 | 4.2e-11 | 43.1 |
| TkA04G064390 | PF28526 | UBA_TNK1-sid3 | 252 | 283 | 0.13 | 13.3 |
| TkA04G064390 | PF02845 | CUE | 260 | 285 | 0.087 | 13.2 |
| TkA04G064390 | PF24559 | UBA_RAD5A | 268 | 286 | 0.012 | 15.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.