TkA04G062610 | RubberDandelionOmics

Gene overview

TkA04G062610

Reference: TK1151 Chr: Chr04 Coordinates: 16727224-16734139 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2681 bp · TkA04G062610|TK1151|cDNA

CTCTGATTTACATAGCAAAACACAGGAGAGATAGATCCGAAGAGAGAGAACAAAGAGGAGAAAAATCCAAGAACGCGAAAGAAAGAAACGAAGATCAAGGGAGAAGCCATTTCCGACGTTGTATCTTGTTACAATGGCGGAAACCAGATGCAATCAATCACATCGCCATAGTCACGTTCATAACTACGCTGTAAAAAAACAATCAAATCCAAGAACATCCACTTACTCTCATATCCATAAACATTAAAACCGAAAACTAA...

CDS

Download CDS FASTA

2175 bp · TkA04G062610|TK1151|CDS

ATGAAGGCATGGGAGGCAACGGTAAGAAAAACACACGCCGTCGCAAGACGACAAGCCAGCAATATCTTCGGATCAGCACACGTTGCAAACATCGATGAAGACGACGACGATGCTCATTCCGCCGGGGAAATCTACCACGCAGAACGGTACCTTTCAAACGGCGATTACTACACCGGCCACTGGTTAGAAAACTTCCCTCACGGTTTCGGCAAATACTGGTGGACCGATGGGTGCATGTACGTCGGCGACTGGTACCATGG...

Protein

Download Protein FASTA

724 aa · TkA04G062610|TK1151|PROTEIN

MKAWEATVRKTHAVARRQASNIFGSAHVANIDEDDDDAHSAGEIYHAERYLSNGDYYTGHWLENFPHGFGKYWWTDGCMYVGDWYHGKTMGKGTFSWPSGANYQGEFKSGYMDGEGTYTGPNGDTYKGSWVMNLKHGNGVREYTNGDIYDGEWCGGLQEGKGKYQWKDGHSYVGEWKNGTMSGTGKLVWSNGNVYEGLWDDSLPKGQGVFKWVDGSFFEGNWSIDKSEQSGEYHPSDKAPDEHKDWCQEKLYEGDLKECV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G062610`
TK1151 ID	TkA04G062610
OH-1004 ID	LXL04_036220
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G062610

Location Chr04:16727224-16734139 (+)

Description Similar to PIP5K4: Phosphatidylinositol 4-phosphate 5-kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07960`	Phosphatidylinositol 4-phosphate 5-kinase 6.	No verified direct reference in this release
`At3g56960`	Phosphatidylinositol 4-phosphate 5-kinase 4.	No verified direct reference in this release
`At2g41210`	Phosphatidylinositol 4-phosphate 5-kinase 5.	No verified direct reference in this release
`At1g21980`	Catalyzes the synthesis of phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4-bisphosphate.	AtPIP5K1, an Arabidopsis thaliana phosphatidylinositol phosphate kinase, synthesizes PtdIns(3,4)P(2) and PtdIns(4,5)P(2) in vitro and is inhibited by phosphorylation.2001 · DOI: 10.1042/0264-6021:3590583
`At1g77740`	Possesses phosphatidylinositol (PtdIns) phosphate kinase activity (Probable).	Arabidopsis Rab-E GTPases exhibit a novel interaction with a plasma-membrane phosphatidylinositol-4-phosphate 5-kinase.2009 · DOI: 10.1242/jcs.053488

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036220 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003006 developmental process involved in reproduction Biological Process

GO:0006897 endocytosis Biological Process

GO:0007164 establishment of tissue polarity Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010311 lateral root formation Biological Process

GO:0046488 phosphatidylinositol metabolic process Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

KEGG gene cross-reference

ath:AT1G21980

ath:AT1G77740

ath:AT2G41210

ath:AT3G07960

ath:AT3G56960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA04G062610 · TK1151

Cell membrane0.388

Rank 2 · TkA04G062610 · TK1151

Nucleus0.236

Rank 3 · TkA04G062610 · TK1151

Golgi apparatus0.070

Rank 4 · TkA04G062610 · TK1151

Endoplasmic reticulum0.064

Rank 5 · TkA04G062610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02493MORN57-79 aa

PF02493MORN80-100 aa

PF02493MORN103-125 aa

PF02493MORN126-147 aa

PF02493MORN149-170 aa

PF02493MORN172-194 aa

PF02493MORN195-216 aa

PF02493MORN218-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G062610	`PF02493`	MORN	57	79	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	80	100	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	103	125	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	126	147	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	149	170	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	172	194	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	195	216	8.9e-37	123.5
TkA04G062610	`PF02493`	MORN	218	223	8.9e-37	123.5
TkA04G062610	`PF01504`	PIP5K	434	715	4.4e-99	332.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFB8`	Arabidopsis thaliana	sp\|Q9SFB8\|PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6	69.300%	Swiss-Prot	High
`Q9M1K2`	Arabidopsis thaliana	sp\|Q9M1K2\|PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4	65.900%	Swiss-Prot	High
`Q9SLG9`	Arabidopsis thaliana	sp\|Q9SLG9\|PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5	65.800%	Swiss-Prot	High
`Q56YP2`	Arabidopsis thaliana	sp\|Q56YP2\|PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1	57.000%	Swiss-Prot	Medium
`Q8L796`	Arabidopsis thaliana	sp\|Q8L796\|PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2	56.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card