RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G062300
Reference: TK1151 Chr: Chr04 Coordinates: 16614043-16623999 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3896 bp · TkA04G062300|TK1151|cDNA

ATCATAAGTGAGACACCGAGGCCTGTTTGGATCTCTAAAAGTCATATTTACTGATCTGGTAGATGTGGTCGTCCATTGGTCTATTCAATCTCAATGACCACCTCCCCTGAGTAACGCTCCACGAAGTTTCTAAATCCTCACTGTTTCGATTCCATTCTCCGATTCTTCTCACTCTAGTTAATTAACCAGCTTTCTGCCGGCGGTGGCCGTGCAACCTGCAATGGTGGAAAGCTATCTAGCAGACGAGTTCCATCTCCCGC...

CDS

Download CDS FASTA

3090 bp · TkA04G062300|TK1151|CDS

ATGGTGGAAAGCTATCTAGCAGACGAGTTCCATCTCCCGCCCAAGCATCCGTCGCCTGAAGCTCTGAAGAACTGGCGCAAAGCCGTCTCCCTCGTCAAAAATCCTAGCCGAAGATTCCGGCATGTCGCTGACCTCGATAAGCGATCTATTCATCAGGACAGATTTTCCAAAATCAAGGAAAATCTACGGGTTAGCTTCTATACTGTGAGAGCAGCACTGCGGTTTATGGACGGCGGTGCTCATTTCGAAAGCCATCATCA...

Protein

Download Protein FASTA

1029 aa · TkA04G062300|TK1151|PROTEIN

MVESYLADEFHLPPKHPSPEALKNWRKAVSLVKNPSRRFRHVADLDKRSIHQDRFSKIKENLRVSFYTVRAALRFMDGGAHFESHHQTPDAKASDIRNNPQSLASMVQNYNTKTLRSLGGVDGVAKAIDVSIDEGVKSSDVSVRQETYGVNKYTEKPSKSFFMFVWEALHDLTLIILIVCSIVSIAVGLATEGFPDGIYDGSGILLSILLVVTVTAVSDYRQSLQFKDLDKEKKKISCHVTRDGYRKKVSIYDLVVGDVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G062300
TK1151 IDTkA04G062300
OH-1004 IDLXL04_036233
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 98.469
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G062300
LocationChr04:16614043-16623999 (+)
DescriptionSimilar to ACA11: Putative calcium-transporting ATPase 11, plasma membrane-type
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g57330 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles. No verified direct reference in this release
At2g41560 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into small vacuoles. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0136900 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles. No verified direct reference in this release
Os11g0140400 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles. No verified direct reference in this release
Os01g0939100 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036233 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009624 response to nematode Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0043069 negative regulation of programmed cell death Biological Process
GO:0051480 regulation of cytosolic calcium ion concentration Biological Process
GO:0055081 monoatomic anion homeostasis Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT2G41560
ath:AT3G57330
dosa:Os01g0939100
dosa:Os12g0136900
osa:4326507
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.505
Rank 1 · TkA04G062300 · TK1151
Endoplasmic reticulum0.181
Rank 2 · TkA04G062300 · TK1151
Lysosome / Vacuole0.170
Rank 3 · TkA04G062300 · TK1151
Cytoplasm0.119
Rank 4 · TkA04G062300 · TK1151
Golgi apparatus0.114
Rank 5 · TkA04G062300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12515CaATP_NAI6-49 aa
PF00690Cation_ATPase_N118-184 aa
PF00689Cation_ATPase_C192-199 aa
PF00122E1-E2_ATPase235-333 aa
PF00689Cation_ATPase_C356-375 aa
PF00702Hydrolase450-473 aa
PF13246Cation_ATPase492-654 aa
PF00702Hydrolase631-758 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G062300PF12515CaATP_NAI6493.6e-1865.5
TkA04G062300PF00690Cation_ATPase_N1181841.1e-1454.5
TkA04G062300PF00689Cation_ATPase_C1921991.6e-43149.3
TkA04G062300PF00122E1-E2_ATPase2353336.7e-2277.9
TkA04G062300PF00689Cation_ATPase_C3563751.6e-43149.3
TkA04G062300PF00702Hydrolase4504738.8e-1659.6
TkA04G062300PF13246Cation_ATPase4926541.8e-29103.5
TkA04G062300PF00702Hydrolase6317588.8e-1659.6
TkA04G062300PF12710HAD6527570.02715.6
TkA04G062300PF08282Hydrolase_36566900.0001922.0
TkA04G062300PF08282Hydrolase_37327860.0001922.0
TkA04G062300PF00689Cation_ATPase_C83110041.6e-43149.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M2L4Arabidopsis thalianasp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type67.400%Swiss-ProtHigh
O22218Arabidopsis thalianasp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type66.600%Swiss-ProtHigh
Q2QY12Oryza sativa subsp. japonicasp|Q2QY12|ACA9_ORYSJ Probable calcium-transporting ATPase 9, plasma membrane-type63.800%Swiss-ProtHigh
Q2RAS0Oryza sativa subsp. japonicasp|Q2RAS0|ACA8_ORYSJ Probable calcium-transporting ATPase 8, plasma membrane-type63.500%Swiss-ProtHigh
Q8RUN1Oryza sativa subsp. japonicasp|Q8RUN1|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type62.700%Swiss-ProtHigh

JBrowse

View in Genome Browser