Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1555 bp · TkA04G060760|TK1151|cDNA
TTTCGAAATCAATGGCTATTTCGATCAAATAGAGAAAAAATGAAAGAAAAAAAAAATTCAATACTCAATGAAACAATTATCCCTTTGATGAATATCCCTAATTATAACTTTCTAAATTAACCTACAAGTAGCAGCTGGAAGAAAGACGGAAGAAGAACAAAAACCTTGCGAGGGTTTAACTAACCAGACCACCAAAATGGGGGGAGTGGAGAAGATACTGAAAAAAGGATTGGGGGAGATGGGCTTCGCCACCGGCGGTG...
1122 bp · TkA04G060760|TK1151|CDS
ATGGGGGGAGTGGAGAAGATACTGAAAAAAGGATTGGGGGAGATGGGCTTCGCCACCGGCGGTGGCACCATCAACTGGTTCCCCGGCCACATGGCAGCCGCCACCCGCGCCATTAACGCCCGCCTCAAACTCGCGGACCTTGTCATCGAAGTCCGCGATTCCCGTATTCCATTGTCGTCTGCAAATCTAGACCTTCAACCTCGTCTATCCACCAAACGGCGTGTAATTGCTCTCAACAAGAAAGATTTAGCTAATCCCAA...
Protein
Download Protein FASTA373 aa · TkA04G060760|TK1151|PROTEIN
MGGVEKILKKGLGEMGFATGGGTINWFPGHMAAATRAINARLKLADLVIEVRDSRIPLSSANLDLQPRLSTKRRVIALNKKDLANPNIMHKWVDYFTFCKQDCLPINAHSRSSVQKLLELVELKLKEKIAKEPTLLVMVVGVPNVGKSALINCIHQIASSRFPMQEKKKRAKVGPLPGVTQDIAGFKIAQRPSIYVLDTPGVLVPTIPNIETGLKLALSGSVKDSVVGEERIAQYLLAVLNTRQTPLHWRNVHNNTQKEM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G060760 |
|---|---|
| TK1151 ID | TkA04G060760 |
| OH-1004 ID | LXL04_036246 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 85.459Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G060760 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:16237381-16239718 (-) | |||||||||
| Description | Similar to SIN2: Short integuments 2, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000911 cytokinesis by cell plate formation Biological Process GO:0006412 translation Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0044065 regulation of respiratory system process Biological Process GO:0048481 plant ovule development Biological Process GO:0070129 regulation of mitochondrial translation Biological Process GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005759 mitochondrial matrix Cellular Component | |||||||||
| KEGG gene cross-reference | afl:Aflv_1757 ath:AT2G41670 ath:AT4G10650 bta:509768 mmu:212508 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01926MMR_HSR135-80 aaPF00009GTP_EFTU41-121 aaPF02421FeoB_N45-117 aaPF03193RsgA_GTPase74-202 aaPF00667FAD_binding_1111-126 aaPF13191AAA_16130-161 aaPF00009GTP_EFTU134-201 aaPF01926MMR_HSR1137-246 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G060760 | PF01926 | MMR_HSR1 | 35 | 80 | 8.7e-14 | 52.3 |
| TkA04G060760 | PF00009 | GTP_EFTU | 41 | 121 | 0.0091 | 16.3 |
| TkA04G060760 | PF02421 | FeoB_N | 45 | 117 | 1.9e-06 | 28.2 |
| TkA04G060760 | PF03193 | RsgA_GTPase | 74 | 202 | 0.0001 | 22.9 |
| TkA04G060760 | PF00667 | FAD_binding_1 | 111 | 126 | 0.14 | 12.5 |
| TkA04G060760 | PF13191 | AAA_16 | 130 | 161 | 0.055 | 14.7 |
| TkA04G060760 | PF00009 | GTP_EFTU | 134 | 201 | 0.0091 | 16.3 |
| TkA04G060760 | PF01926 | MMR_HSR1 | 137 | 246 | 8.7e-14 | 52.3 |
| TkA04G060760 | PF02421 | FeoB_N | 137 | 202 | 1.9e-06 | 28.2 |
| TkA04G060760 | PF00667 | FAD_binding_1 | 270 | 354 | 0.14 | 12.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.