TkA04G060630 | RubberDandelionOmics

Gene overview

TkA04G060630

Reference: TK1151 Chr: Chr04 Coordinates: 16190045-16192492 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · TkA04G060630|TK1151|cDNA

ATGGCTACTGCAACTTCCTCTGATCCTGTAATGAAATCGGAGGGCAGTGCCAGTGGCGGGATGGCGGCGGCCGCCGCGGTGGTAGTAAAGGGGAACAATTATCAGCAGCAGTTGATGGTGAAGTATAAAGGGATTAAGAAATCGAAGAAGGATAGAGGTTGTACGGCTAAAGAACGCATCAGTAAAATGCCTCCTTGTGCTGCTGGGAAACGTAGCTCTATCTACAGAGGCGTCACTAGGCATAGATGGACTGGTCGTTA...

CDS

Download CDS FASTA

1233 bp · TkA04G060630|TK1151|CDS

ATGGCTACTGCAACTTCCTCTGATCCTGTAATGAAATCGGAGGGCAGTGCCAGTGGCGGGATGGCGGCGGCCGCCGCGGTGGTAGTAAAGGGGAACAATTATCAGCAGCAGTTGATGGTGAAGTATAAAGGGATTAAGAAATCGAAGAAGGATAGAGGTTGTACGGCTAAAGAACGCATCAGTAAAATGCCTCCTTGTGCTGCTGGGAAACGTAGCTCTATCTACAGAGGCGTCACTAGGCATAGATGGACTGGTCGTTA...

Protein

Download Protein FASTA

410 aa · TkA04G060630|TK1151|PROTEIN

MATATSSDPVMKSEGSASGGMAAAAAVVVKGNNYQQQLMVKYKGIKKSKKDRGCTAKERISKMPPCAAGKRSSIYRGVTRHRWTGRYEAHLWDKSTWNQNQNKKGKQGLIPPLCAYDDEEAAARAYDLAALKYWGPGTLINFPVTDYTRDLEEMQNLTREDYLASLRRKGSGFSRGNSKCRGISSTRWDSPLGRGPDYDNRMHHGDETPTENEYVGGFRMDRKIDLTPYIKWWAPTKSRQAAEKSSDETNTNHASSEDTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G060630`
TK1151 ID	TkA04G060630
OH-1004 ID	LXL04_036249
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 96.341 / OH-1004 21.920 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G060630

Location Chr04:16190045-16192492 (+)

Description Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41710`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g54320`	May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).	Contrapuntal networks of gene expression during Arabidopsis seed filling.2002 · DOI: 10.1105/tpc.000877 WRINKLED1 encodes an AP2/EREB domain protein involved in the control of storage compound biosynthesis in Arabidopsis.2004 · DOI: 10.1111/j.1365-313x.2004.02235.x ACTIVATOR of Spomin::LUC1/WRINKLED1 of Arabidopsis thaliana transactivates sugar-inducible promoters.2005 · DOI: 10.1093/pcp/pci072 A spatiotemporal analysis of enzymatic activities associated with carbon metabolism in wild-type and mutant embryos of Arabidopsis using in situ histochemistry.2006 · DOI: 10.1111/j.1365-313x.2006.02682.x WRI1 is required for seed germination and seedling establishment.2006 · DOI: 10.1104/pp.106.079574 wrinkled1: A novel, low-seed-oil mutant of Arabidopsis with a deficiency in the seed-specific regulation of carbohydrate metabolism.1998 · DOI: 10.1104/pp.118.1.91
`At1g79700`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g16060`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0389000`	Transcription activator involved in the control of organ size.	A novel AP2-type transcription factor, SMALL ORGAN SIZE1, controls organ size downstream of an auxin signaling pathway.2014 · DOI: 10.1093/pcp/pcu023 SMALL ORGAN SIZE 1 and SMALL ORGAN SIZE 2/DWARF AND LOW-TILLERING Form a Complex to Integrate Auxin and Brassinosteroid Signaling in Rice.2017 · DOI: 10.1016/j.molp.2016.12.013 The RLA1/SMOS1 Transcription Factor Functions with OsBZR1 to Regulate Brassinosteroid Signaling and Rice Architecture.2017 · DOI: 10.1105/tpc.16.00611

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036249 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006508 proteolysis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0015074 DNA integration Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G41710

dosa:Os05g0389000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.932

Rank 1 · TkA04G060630 · TK1151

Cytoplasm0.104

Rank 2 · TkA04G060630 · TK1151

Cell membrane0.044

Rank 3 · TkA04G060630 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkA04G060630 · TK1151

Plastid0.021

Rank 5 · TkA04G060630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP275-135 aa

PF00847AP2266-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G060630	`PF00847`	AP2	75	135	3.6e-06	27.9
TkA04G060630	`PF00847`	AP2	266	273	3.6e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWK2`	Arabidopsis thaliana	sp\|Q8GWK2\|AP2L4_ARATH AP2-like ethylene-responsive transcription factor At2g41710	55.300%	Swiss-Prot	High
`Q6X5Y6`	Arabidopsis thaliana	sp\|Q6X5Y6\|WRI1_ARATH Ethylene-responsive transcription factor WRI1	66.700%	Swiss-Prot	Low
`A0JPZ8`	Arabidopsis thaliana	sp\|A0JPZ8\|AP2L3_ARATH AP2-like ethylene-responsive transcription factor At1g79700	59.000%	Swiss-Prot	Low
`Q94AN4`	Arabidopsis thaliana	sp\|Q94AN4\|AP2L1_ARATH AP2-like ethylene-responsive transcription factor At1g16060	57.300%	Swiss-Prot	Low
`X5HYT8`	Oryza sativa subsp. japonica	sp\|X5HYT8\|SMOS1_ORYSJ AP2-like ethylene-responsive transcription factor SMOS1	48.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card