Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3227 bp · TkA04G059440|TK1151|cDNA
ATACGATGTTCCCCATGCCTTCTCCACTGCAAAACAGGACTCCGAACGACGACTGGAGCATCAAGAAACCATGGCAGTCGGAAAGAAAAACTTAGAGGTGGTGGAGATAATCAAGCCCCGAATGGACACCAGAGACTACAAAAGAATAGTTCTTCCCAACTCTCTTCAAGTTCTTCTCATCAGCGATCCTGATCCTGATAAGTGTGCAGCCTCAATGAGTGTTGGTGTTGGTTCGTTTAGCAATCCTGAAGGTCTCGAAG...
2904 bp · TkA04G059440|TK1151|CDS
ATGGCAGTCGGAAAGAAAAACTTAGAGGTGGTGGAGATAATCAAGCCCCGAATGGACACCAGAGACTACAAAAGAATAGTTCTTCCCAACTCTCTTCAAGTTCTTCTCATCAGCGATCCTGATCCTGATAAGTGTGCAGCCTCAATGAGTGTTGGTGTTGGTTCGTTTAGCAATCCTGAAGGTCTCGAAGGCCTTGCTCATTTCCTTGAACACATGCTCTTCTACGCCAGTGAGAAGTACCCATTGGAGTATAGTTATTC...
Protein
Download Protein FASTA967 aa · TkA04G059440|TK1151|PROTEIN
MAVGKKNLEVVEIIKPRMDTRDYKRIVLPNSLQVLLISDPDPDKCAASMSVGVGSFSNPEGLEGLAHFLEHMLFYASEKYPLEYSYSTYISEHGGRTNAYTSTQHTNYYFDVNADCFEEALDRFAQFFIKPLMSSDATTREIKAVDSENQKNLLSDVWRINQLQKHLSADCHPYHKFNTGNWDTLEVRPKARGVDTRDELLKFYKEYYSANLMNLVVYTKESLDKIESIVLSKFKEIRNIDRIHPSFPGQPCTSEHLQII...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G059440 |
|---|---|
| TK1151 ID | TkA04G059440 |
| OH-1004 ID | LXL04_036264 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 91.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 92.981Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G059440 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:15875692-15885992 (+) | |||||||||
| Description | Similar to PXM16: Insulin-degrading enzyme-like 1, peroxisomal | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0006979 response to oxidative stress Biological Process GO:0010815 bradykinin catabolic process Biological Process GO:0010992 ubiquitin recycling Biological Process GO:0019885 antigen processing and presentation of endogenous peptide antigen via MHC class I Biological Process GO:0030163 protein catabolic process Biological Process GO:0032092 positive regulation of protein binding Biological Process GO:0042447 hormone catabolic process Biological Process GO:0043171 peptide catabolic process Biological Process GO:0045732 positive regulation of protein catabolic process Biological Process GO:0045861 negative regulation of proteolysis Biological Process GO:0050435 amyloid-beta metabolic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G41790 ath:AT3G57470 bta:523752 hsa:3416 rno:25700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00675Peptidase_M1634-168 aaPF05193Peptidase_M16_C85-128 aaPF05193Peptidase_M16_C196-373 aaPF16187Peptidase_M16_M381-660 aaPF11333DUF3135657-678 aaPF05193Peptidase_M16_C667-852 aaPF11333DUF3135771-840 aaPF22456PqqF-like_C_4772-871 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G059440 | PF00675 | Peptidase_M16 | 34 | 168 | 9.7e-36 | 123.6 |
| TkA04G059440 | PF05193 | Peptidase_M16_C | 85 | 128 | 1.3e-41 | 143.1 |
| TkA04G059440 | PF05193 | Peptidase_M16_C | 196 | 373 | 1.3e-41 | 143.1 |
| TkA04G059440 | PF16187 | Peptidase_M16_M | 381 | 660 | 1e-99 | 334.0 |
| TkA04G059440 | PF11333 | DUF3135 | 657 | 678 | 0.099 | 13.7 |
| TkA04G059440 | PF05193 | Peptidase_M16_C | 667 | 852 | 1.3e-41 | 143.1 |
| TkA04G059440 | PF11333 | DUF3135 | 771 | 840 | 0.099 | 13.7 |
| TkA04G059440 | PF22456 | PqqF-like_C_4 | 772 | 871 | 1.9e-23 | 83.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.