TkA04G055120 | RubberDandelionOmics

Gene overview

TkA04G055120

Reference: TK1151 Chr: Chr04 Coordinates: 14712243-14715104 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2128 bp · TkA04G055120|TK1151|cDNA

CTCATGATTCTTATTTTTTTTATTGATTAATCCATCATTAACCAATAACCATCTAAATCTTGCATCGACATCGTATTGTCGCATTTCCTCTCCCTGTCCTAACACTCTCACTCTCCACACAACTTCATCACCCCCAGATCCGTTTCTCCACCATAACCATGGCGGAGACACCACCACCGGAACAACCCTCAACGCCATCTCCACCACCGCCTCCCTACATACACTCACGCCGTGAACCTTTCGAGCATGGCCTCATCCCT...

CDS

Download CDS FASTA

1740 bp · TkA04G055120|TK1151|CDS

ATGGCGGAGACACCACCACCGGAACAACCCTCAACGCCATCTCCACCACCGCCTCCCTACATACACTCACGCCGTGAACCTTTCGAGCATGGCCTCATCCCTTTGCAGAAATTCATCTTCACAGATGCCGCACAAACCCTAACCTCTCTCCGTGACAAACTTCTCCAGCATCCGGTTTCGGCTGATCAACCACACCGCATTAGCTCCGTCGTTCTATCTGAAACGTTACAGATCCCCCCAGAACACGCCCGCCTTGTCTT...

Protein

Download Protein FASTA

579 aa · TkA04G055120|TK1151|PROTEIN

MAETPPPEQPSTPSPPPPPYIHSRREPFEHGLIPLQKFIFTDAAQTLTSLRDKLLQHPVSADQPHRISSVVLSETLQIPPEHARLVFEIIASVHPSDSDPLVMAKPDEIDSVGVNVYDLIVFLYIQSYKRLLPRGHKDSAAIADVWPSTSAFDGFLSALTPLQLARSNVRRSMPSQADEEAHQLSYLQKHLGNIISLLADTVEGQGEAEAEGDAEGEDSLVLTLENFEHLDFLIYFGEKGSEKIPLSQNAPFFANSDPDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G055120`
TK1151 ID	TkA04G055120
OH-1004 ID	LXL04_000406
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.700
Protein coverage (%)	TK1151 98.100 / OH-1004 97.557 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G055120`
Location	Chr04:14712243-14715104 (-)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000406` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008360 regulation of cell shape Biological Process GO:0030334 regulation of cell migration Biological Process GO:0051661 maintenance of centrosome location Biological Process GO:0051684 maintenance of Golgi location Biological Process GO:0031616 spindle pole centrosome Cellular Component
KEGG gene cross-reference	bta:538314 gga:424869 hsa:55171 mmu:70573 rno:303830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552

Rank 1 · TkA04G055120 · TK1151

Nucleus0.376

Rank 2 · TkA04G055120 · TK1151

Cell membrane0.136

Rank 3 · TkA04G055120 · TK1151

Lysosome / Vacuole0.108

Rank 4 · TkA04G055120 · TK1151

Golgi apparatus0.084

Rank 5 · TkA04G055120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15371DUF4599167-193 aa

PF08603CAP_C342-414 aa

PF07986TBCC346-458 aa

PF15371DUF4599536-575 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G055120	`PF15371`	DUF4599	167	193	0.01	16.8
TkA04G055120	`PF08603`	CAP_C	342	414	0.01	16.2
TkA04G055120	`PF07986`	TBCC	346	458	7.3e-33	113.7
TkA04G055120	`PF15371`	DUF4599	536	575	0.01	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card