TkA04G048290 | RubberDandelionOmics

Gene overview

TkA04G048290

Reference: TK1151 Chr: Chr04 Coordinates: 12952388-12953068 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

681 bp · TkA04G048290|TK1151|cDNA

ATGCATCCGCTCCCTCCCCTGGCCGATCATCTTCCTCGGGGTTCTCTTCCTCCTCCTCGCCCTCACAGGCTTCATCGGAGATCACTGGAACAACCAGGTGTTATTGTCCTTTTACCTCTTCTGCACGCCGCACTCATAGTCACCGGAATCATCCTCCTCATACTCGCTTTCATAGTCGTCACCCTTCCGGCGAATACTCCGTTCCCGGTCGGGAATATGACGAGTATCGGTACATGGGGTACTCGGAGTGGCTCGGGAAC...

CDS

Download CDS FASTA

681 bp · TkA04G048290|TK1151|CDS

ATGCATCCGCTCCCTCCCCTGGCCGATCATCTTCCTCGGGGTTCTCTTCCTCCTCCTCGCCCTCACAGGCTTCATCGGAGATCACTGGAACAACCAGGTGTTATTGTCCTTTTACCTCTTCTGCACGCCGCACTCATAGTCACCGGAATCATCCTCCTCATACTCGCTTTCATAGTCGTCACCCTTCCGGCGAATACTCCGTTCCCGGTCGGGAATATGACGAGTATCGGTACATGGGGTACTCGGAGTGGCTCGGGAAC...

Protein

Download Protein FASTA

226 aa · TkA04G048290|TK1151|PROTEIN

MHPLPPLADHLPRGSLPPPRPHRLHRRSLEQPGVIVLLPLLHAALIVTGIILLILAFIVVTLPANTPFPVGNMTSIGTWGTRSGSGTYHDPENWRSIRACLASSSICTKMVRDSYSAPSRVLRRPYLLSPVGCCKPPKVCGYQYVNPITWINPTNPVGDVDCMIWNNDPNQLCYNCHSCKAGVLGNLRKEWKEANVILIVAVVALVCLYLIAFNAYKNAQGGQKKN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G048290`
TK1151 ID	TkA04G048290
OH-1004 ID	LXL04_018612
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.200
Protein coverage (%)	TK1151 81.416 / OH-1004 70.498 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G048290

Location Chr04:12952388-12953068 (-)

Description Similar to TET2: Tetraspanin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19580`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018612 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009554 megasporogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G19580

ath:AT3G45600

ath:AT4G28050

ath:AT4G30430

ath:AT5G46700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.411

Rank 1 · TkA04G048290 · TK1151

Lysosome / Vacuole0.221

Rank 2 · TkA04G048290 · TK1151

Extracellular0.157

Rank 3 · TkA04G048290 · TK1151

Endoplasmic reticulum0.149

Rank 4 · TkA04G048290 · TK1151

Cytoplasm0.146

Rank 5 · TkA04G048290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20088DUF648035-52 aa

PF00335Tetraspanin40-58 aa

PF12351Fig141-72 aa

PF11190DUF297642-65 aa

PF00335Tetraspanin131-211 aa

PF20088DUF6480186-213 aa

PF11190DUF2976187-212 aa

PF12351Fig1195-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G048290	`PF20088`	DUF6480	35	52	0.022	15.4
TkA04G048290	`PF00335`	Tetraspanin	40	58	1.8e-05	25.2
TkA04G048290	`PF12351`	Fig1	41	72	0.25	12.0
TkA04G048290	`PF11190`	DUF2976	42	65	0.14	12.9
TkA04G048290	`PF00335`	Tetraspanin	131	211	1.8e-05	25.2
TkA04G048290	`PF20088`	DUF6480	186	213	0.022	15.4
TkA04G048290	`PF11190`	DUF2976	187	212	0.14	12.9
TkA04G048290	`PF12351`	Fig1	195	213	0.25	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUN5`	Arabidopsis thaliana	sp\|Q9ZUN5\|TET2_ARATH Tetraspanin-2	35.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card