TkA04G046590 | RubberDandelionOmics

Gene overview

TkA04G046590

Reference: TK1151 Chr: Chr04 Coordinates: 12553487-12554731 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1155 bp · TkA04G046590|TK1151|cDNA

ATGGCAATTTCTCTGTATATTTCCCGTTTTAACCTTCTGATACACATTTATTTACTCTCCTACCTCCCGGCCCTTATCTACGCCGTCAACATTACCCATCTTTTATCCCCCTACCCAGACCTCTCCGACTTTTCCGACCTCCTATCCACCACCACCGTCGCCACCGACATCTCCCACCACACCTCCATCACCCTCCTCGCCGTCCCCAACTCAAACCTCCGCTCTTCTGACCTTATCCGTCGCTACTCATCCGCCAATGT...

CDS

Download CDS FASTA

1155 bp · TkA04G046590|TK1151|CDS

ATGGCAATTTCTCTGTATATTTCCCGTTTTAACCTTCTGATACACATTTATTTACTCTCCTACCTCCCGGCCCTTATCTACGCCGTCAACATTACCCATCTTTTATCCCCCTACCCAGACCTCTCCGACTTTTCCGACCTCCTATCCACCACCACCGTCGCCACCGACATCTCCCACCACACCTCCATCACCCTCCTCGCCGTCCCCAACTCAAACCTCCGCTCTTCTGACCTTATCCGTCGCTACTCATCCGCCAATGT...

Protein

Download Protein FASTA

384 aa · TkA04G046590|TK1151|PROTEIN

MAISLYISRFNLLIHIYLLSYLPALIYAVNITHLLSPYPDLSDFSDLLSTTTVATDISHHTSITLLAVPNSNLRSSDLIRRYSSANVADVVRYHVLLQYLTLHDLRRYPPSGKLVTTLFQTTGRAADTFGSVNVTHSSDTTTIRSPAGYSLSPNNATVISVIVTLPYNVSIITINSLIIPNGFDLMASRSRPSLGFNITQALIDGHSFNVVASMLSASGVVQEFESEEGGAGITLFVPTDDAFADLPATANLQSLSADKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G046590`
TK1151 ID	TkA04G046590
OH-1004 ID	LXL04_017801
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.000
Protein coverage (%)	TK1151 92.448 / OH-1004 86.099 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G046590

Location Chr04:12553487-12554731 (-)

Description Similar to FLA4: Fasciclin-like arabinogalactan protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46550`	May be a cell surface adhesion protein that is required for normal cell expansion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007155 cell adhesion Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G45470

ath:AT3G46550

ath:AT3G60900

ath:AT4G12730

ath:AT5G55730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.489

Rank 1 · TkA04G046590 · TK1151

Extracellular0.186

Rank 2 · TkA04G046590 · TK1151

Endoplasmic reticulum0.141

Rank 3 · TkA04G046590 · TK1151

Cytoplasm0.094

Rank 4 · TkA04G046590 · TK1151

Lysosome / Vacuole0.062

Rank 5 · TkA04G046590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469Fasciclin40-179 aa

PF02469Fasciclin207-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G046590	`PF02469`	Fasciclin	40	179	1.6e-18	67.8
TkA04G046590	`PF02469`	Fasciclin	207	290	1.6e-18	67.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SNC3`	Arabidopsis thaliana	sp\|Q9SNC3\|FLA4_ARATH Fasciclin-like arabinogalactan protein 4	49.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card