Gene Card
Gene overview
cDNA / CDS / Protein Sequences
321 bp · TkA04G040030|TK1151|cDNA
ATGATGACAAAAGATCCGTCTTTTATCGTCAAGCAAAACATGAGGATTTTTTTCGACAAAATACTTCCGAGTGCCTTCATTATCTGCGAAAGAAACAAAGATGGATGCGTGAGATACTTTTGTCTGAATCTATGGCATAATGTGGTGGTTAGTTTGAGCACCAAACCATCTTCACATTACAAAATAATGGAGGATAAAGATCCAAATTGCTATTTTGCACAAATAATAGAAGTTGATAGACTACGTTACCAATTAGCAGT...
321 bp · TkA04G040030|TK1151|CDS
ATGATGACAAAAGATCCGTCTTTTATCGTCAAGCAAAACATGAGGATTTTTTTCGACAAAATACTTCCGAGTGCCTTCATTATCTGCGAAAGAAACAAAGATGGATGCGTGAGATACTTTTGTCTGAATCTATGGCATAATGTGGTGGTTAGTTTGAGCACCAAACCATCTTCACATTACAAAATAATGGAGGATAAAGATCCAAATTGCTATTTTGCACAAATAATAGAAGTTGATAGACTACGTTACCAATTAGCAGT...
Protein
Download Protein FASTA106 aa · TkA04G040030|TK1151|PROTEIN
MMTKDPSFIVKQNMRIFFDKILPSAFIICERNKDGCVRYFCLNLWHNVVVSLSTKPSSHYKIMEDKDPNCYFAQIIEVDRLRYQLAVHSYKQSLGKFYRIEPKLRF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G040030 |
|---|---|
| TK1151 ID | TkA04G040030 |
| OH-1004 ID | LXL04_036351 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 60.500 |
| Protein coverage (%) | TK1151 71.698 / OH-1004 13.808Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G040030 |
|---|---|
| Location | Chr04:10691780-10692138 (+) |
| Description | Similar to RUK: Serine/threonine-protein kinase RUNKEL |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000226 microtubule cytoskeleton organization Biological Process GO:0000911 cytokinesis by cell plate formation Biological Process GO:0000914 phragmoplast assembly Biological Process GO:0007349 cellularization Biological Process GO:0009555 pollen development Biological Process GO:0009556 microsporogenesis Biological Process GO:0009966 regulation of signal transduction Biological Process GO:0010245 radial microtubular system formation Biological Process GO:0010342 endosperm cellularization Biological Process GO:0042313 protein kinase C deactivation Biological Process GO:0043408 regulation of MAPK cascade Biological Process GO:0046328 regulation of JNK cascade Biological Process |
| KEGG gene cross-reference | ath:AT5G18700 hsa:54986 pon:100173957 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23606HEAT_ULK43-59 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G040030 | PF23606 | HEAT_ULK4 | 3 | 59 | 3.9e-05 | 23.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.