Gene Card
Gene overview
cDNA / CDS / Protein Sequences
603 bp · TkA04G036870|TK1151|cDNA
AGGTTCTAGAGAAATCAGTTTCAATCGAGTTCATCCTTCCAGTCGATTCTACACCCTAAATTGGGTTTATTCGTGGCCATCGCAGTCTTCAACAGGTCTCCAAATTGGTCTAATCTCATCATTTTTCGTAGAAACTGTAGCAATTTGTTGAATTCCAACATCCCTAACCGAACTATAACAATACCATCATTCGATACAGATTCTGGTGAACTAGTTGTCCTCAATAATGGCGAAACATCATCCTGATTTGATTATGTGCC...
333 bp · TkA04G036870|TK1151|CDS
ATGGCGAAACATCATCCTGATTTGATTATGTGCCGAAAGCAACCAGGAATCGCAATCGGAAGGCTCTGCGAAAAATGCGATGGAAAGTGCGTGATCTGTGATTCTTACGTGCGTCCGTGCACACTCGTACGCGTCTGCGATGAGTGCAACTATGGTTCATTTCAAGGTCGGTGTGTGATATGTGGAGGTGTAGGGATTTCCGATGCGTATTATTGCAAAGAGTGCACACAGCAGGAAAAAGATCGAGATGGCTGCCCAAA...
Protein
Download Protein FASTA110 aa · TkA04G036870|TK1151|PROTEIN
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G036870 |
|---|---|
| TK1151 ID | TkA04G036870 |
| OH-1004 ID | LXL04_033481 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 91.818 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G036870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:9854735-9855449 (+) | |||||||||
| Description | Similar to At1g07170: PHD finger-like domain-containing protein 5B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048863 stem cell differentiation Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005684 U2-type spliceosomal complex Cellular Component GO:0005686 U2 snRNP Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G07170 ath:AT2G30000 hsa:84844 mmu:68479 rno:192246 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03660PHF510-104 aaPF18912DZR_210-49 aaPF18912DZR_257-79 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G036870 | PF03660 | PHF5 | 10 | 104 | 3e-44 | 149.9 |
| TkA04G036870 | PF18912 | DZR_2 | 10 | 49 | 0.068 | 13.7 |
| TkA04G036870 | PF18912 | DZR_2 | 57 | 79 | 0.068 | 13.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.