TkA04G035540 | RubberDandelionOmics

Gene overview

TkA04G035540

Reference: TK1151 Chr: Chr04 Coordinates: 9556347-9557405 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1029 bp · TkA04G035540|TK1151|cDNA

ATGCCAGGGGGTACGGTTTCTGACGTTGCCGGCGAGCATGTCCGGAGTTACACGCGGTGCATCACGTCGGCGTTGAGCTACATTCACGCGAGAGGCATCGTTCATTGCGACGTCAAGGGGAAGAATGTGTTGATCGGAAACACTCCCGGTACCGCGAAGCTTGCTGATTTTGGGTCAGCGATTGAATTGGGGAGTCCGGTGACAGGAACACGTGGGAGTCCATTGTGGATGGCGCCGGAGGTCATCAGAGGCGAGTATCA...

CDS

Download CDS FASTA

1029 bp · TkA04G035540|TK1151|CDS

ATGCCAGGGGGTACGGTTTCTGACGTTGCCGGCGAGCATGTCCGGAGTTACACGCGGTGCATCACGTCGGCGTTGAGCTACATTCACGCGAGAGGCATCGTTCATTGCGACGTCAAGGGGAAGAATGTGTTGATCGGAAACACTCCCGGTACCGCGAAGCTTGCTGATTTTGGGTCAGCGATTGAATTGGGGAGTCCGGTGACAGGAACACGTGGGAGTCCATTGTGGATGGCGCCGGAGGTCATCAGAGGCGAGTATCA...

Protein

Download Protein FASTA

342 aa · TkA04G035540|TK1151|PROTEIN

MPGGTVSDVAGEHVRSYTRCITSALSYIHARGIVHCDVKGKNVLIGNTPGTAKLADFGSAIELGSPVTGTRGSPLWMAPEVIRGEYQGPESDVWSLGCTVIEILTGKPAWRDRGADTLRQIGYSDDLPEITLPLTDDLRDFINKCLRRDRNERWSCDQLLHHPFLLSCSPPSPPQITINTCKFSPRCVFDWSASSSSNESTIEIHQFDTMNSEAKQRIGKLASTSGANWESEGWEIVRNATTLEYSDSIDYEESVSESNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G035540`
TK1151 ID	TkA04G035540
OH-1004 ID	LXL04_036580
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.100
Protein coverage (%)	TK1151 80.409 / OH-1004 75.597 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G035540

Location Chr04:9556347-9557405 (-)

Description Similar to MAPKKK17: Mitogen-activated protein kinase kinase kinase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32510`	Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses.	No verified direct reference in this release
`At1g05100`	Component of the abscisic acid (ABA) signaling pathway that acts as ABA signal transducer in the context of abiotic stresses.	An abscisic acid inducible Arabidopsis MAPKKK, MAPKKK18 regulates leaf senescence via its kinase activity.2015 · DOI: 10.1007/s11103-015-0295-0 Arabidopsis ABA-Activated Kinase MAPKKK18 is Regulated by Protein Phosphatase 2C ABI1 and the Ubiquitin-Proteasome Pathway.2015 · DOI: 10.1093/pcp/pcv146
`At1g53570`	Mitogen-activated protein kinase kinase kinase 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036580 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0030435 sporulation resulting in formation of a cellular spore Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G05100

ath:AT1G09000

ath:AT1G53570

ath:AT2G32510

ddi:DDB_G0283265

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · TkA04G035540 · TK1151

Nucleus0.340

Rank 2 · TkA04G035540 · TK1151

Cell membrane0.223

Rank 3 · TkA04G035540 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA04G035540 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA04G035540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase12-165 aa

PF07714PK_Tyr_Ser-Thr13-160 aa

PF03109ABC119-63 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G035540	`PF00069`	Pkinase	12	165	1.8e-39	136.5
TkA04G035540	`PF07714`	PK_Tyr_Ser-Thr	13	160	2.4e-20	73.7
TkA04G035540	`PF03109`	ABC1	19	63	0.096	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80888`	Arabidopsis thaliana	sp\|O80888\|M3K17_ARATH Mitogen-activated protein kinase kinase kinase 17	45.600%	Swiss-Prot	Medium
`Q9ZVP5`	Arabidopsis thaliana	sp\|Q9ZVP5\|M3K18_ARATH Mitogen-activated protein kinase kinase kinase 18	47.300%	Swiss-Prot	Low
`F4HRJ4`	Arabidopsis thaliana	sp\|F4HRJ4\|M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3	43.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card