TkA04G030030 | RubberDandelionOmics

Gene overview

TkA04G030030

Reference: TK1151 Chr: Chr04 Coordinates: 7931515-7932106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · TkA04G030030|TK1151|cDNA

ATGGAGACAGTTGCTCTGTACAATACTAGATGGTTGTCGGTCATTTTACAAGGCTTAACAGGTGTTTACTATCGATCCGGGCAATTTCTAGGGAGGGGAAGCATGGCAGACACATATGCTTATGTGGTACACGACACATTAACAATGACTGTTAAAAGTCTAGACTGGGGATACATTACGGACGACAAAAACTTTTTCATAGAGCAGATGGATCGGGTAGGGAGAGTGGTACCCTTCGCGAGCAATGTAATACCCCTGCG...

CDS

Download CDS FASTA

531 bp · TkA04G030030|TK1151|CDS

ATGGAGACAGTTGCTCTGTACAATACTAGATGGTTGTCGGTCATTTTACAAGGCTTAACAGGTGTTTACTATCGATCCGGGCAATTTCTAGGGAGGGGAAGCATGGCAGACACATATGCTTATGTGGTACACGACACATTAACAATGACTGTTAAAAGTCTAGACTGGGGATACATTACGGACGACAAAAACTTTTTCATAGAGCAGATGGATCGGGTAGGGAGAGTGGTACCCTTCGCGAGCAATGTAATACCCCTGCG...

Protein

Download Protein FASTA

176 aa · TkA04G030030|TK1151|PROTEIN

METVALYNTRWLSVILQGLTGVYYRSGQFLGRGSMADTYAYVVHDTLTMTVKSLDWGYITDDKNFFIEQMDRVGRVVPFASNVIPLRGYIFSKARKLLIYDMVEGSTLRSRLHGTKQGNQMDLNFLIRVAIEVAKGIRHIHSFGQQSVHANLKSANIFITNDDRKILVSEMGLVPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G030030`
TK1151 ID	TkA04G030030
OH-1004 ID	LXL04_019339
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.900
Protein coverage (%)	TK1151 85.795 / OH-1004 24.149 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G030030

Location Chr04:7931515-7932106 (-)

Description Similar to At5g58300: Probable inactive receptor kinase At5g58300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25390`	Receptor-like serine/threonine-protein kinase At4g25390.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:2000605 positive regulation of secondary growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G26730

ath:AT3G08680

ath:AT4G23740

ath:AT5G05160

ath:AT5G58300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.419

Rank 1 · TkA04G030030 · TK1151

Cell membrane0.354

Rank 2 · TkA04G030030 · TK1151

Nucleus0.267

Rank 3 · TkA04G030030 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA04G030030 · TK1151

Plastid0.039

Rank 5 · TkA04G030030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase24-172 aa

PF07714PK_Tyr_Ser-Thr28-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G030030	`PF00069`	Pkinase	24	172	4.9e-10	40.0
TkA04G030030	`PF07714`	PK_Tyr_Ser-Thr	28	174	1.4e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STJ8`	Arabidopsis thaliana	sp\|Q9STJ8\|Y4539_ARATH Receptor-like serine/threonine-protein kinase At4g25390	23.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card