TkA04G029970 | RubberDandelionOmics

Gene overview

TkA04G029970

Reference: TK1151 Chr: Chr04 Coordinates: 7916500-7918297 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

413 bp · TkA04G029970|TK1151|cDNA

CAAGGCATCTCAATTTCATCCAGCATAGCAGTCGGTTGGGCTGGAAATTGAACAAGAGAGGAAAGCCGATAATGATCGATCCAGGTCTTTACAGTTCAAATAAATCAGATATATGGTGGGTAATTAAGCAAAGAGCTCTCCCGACTGCTTTCAAGTTATATACAGGTTCAGCATGGACTATACTCTCAAGATCATTTACAGAATATTGCATAATCGGATACGAAAACCTCCCAAGAACTCTCCTACTTTACTACACAAAC...

CDS

Download CDS FASTA

342 bp · TkA04G029970|TK1151|CDS

ATGATCGATCCAGGTCTTTACAGTTCAAATAAATCAGATATATGGTGGGTAATTAAGCAAAGAGCTCTCCCGACTGCTTTCAAGTTATATACAGGTTCAGCATGGACTATACTCTCAAGATCATTTACAGAATATTGCATAATCGGATACGAAAACCTCCCAAGAACTCTCCTACTTTACTACACAAACTTCGTGTCATCACCCAAAGGCTACTTTCAAACCGTTATATGCAACTCAAAACAATACAAAAACACAACGGT...

Protein

Download Protein FASTA

114 aa · TkA04G029970|TK1151|PROTEIN

MIDPGLYSSNKSDIWWVIKQRALPTAFKLYTGSAWTILSRSFTEYCIIGYENLPRTLLLYYTNFVSSPKGYFQTVICNSKQYKNTTVNHDLHYITWDTPPKQHPRSLGPRDYRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G029970`
TK1151 ID	TkA04G029970
OH-1004 ID	LXL04_018532
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 21.923 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G029970

Location Chr04:7916500-7918297 (+)

Description Similar to GLCAT14B: Beta-glucuronosyltransferase GlcAT14B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39990`	Beta-glucuronosyltransferase involved in the biosynthesis of type II arabinogalactan (AG).	A β-glucuronosyltransferase from Arabidopsis thaliana involved in biosynthesis of type II arabinogalactan has a role in cell elongation during seedling growth.2013 · DOI: 10.1111/tpj.12353
`At5g15050`	Beta-glucuronosyltransferase involved in the biosynthesis of type II arabinogalactan (AG).	Arabidopsis thaliana glucuronosyltransferase in family GT14.2014 · DOI: 10.4161/psb.28891
`At2g37585`	Beta-glucuronosyltransferase involved in the biosynthesis of type II arabinogalactan (AG).	Arabidopsis thaliana glucuronosyltransferase in family GT14.2014 · DOI: 10.4161/psb.28891

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018532 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006024 glycosaminoglycan biosynthetic process Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0015012 heparan sulfate proteoglycan biosynthetic process Biological Process

GO:0030166 proteoglycan biosynthetic process Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0050650 chondroitin sulfate proteoglycan biosynthetic process Biological Process

GO:0070555 response to interleukin-1 Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G37585

ath:AT5G15050

ath:AT5G39990

cfa:494008

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.425

Rank 1 · TkA04G029970 · TK1151

Endoplasmic reticulum0.118

Rank 2 · TkA04G029970 · TK1151

Cytoplasm0.083

Rank 3 · TkA04G029970 · TK1151

Lysosome / Vacuole0.054

Rank 4 · TkA04G029970 · TK1151

Extracellular0.053

Rank 5 · TkA04G029970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02485Branch2-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G029970	`PF02485`	Branch	2	113	5.3e-27	95.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLD7`	Arabidopsis thaliana	sp\|Q9FLD7\|GT14A_ARATH Beta-glucuronosyltransferase GlcAT14A	62.300%	Swiss-Prot	High
`Q9LFQ0`	Arabidopsis thaliana	sp\|Q9LFQ0\|GT14B_ARATH Beta-glucuronosyltransferase GlcAT14B	60.500%	Swiss-Prot	High
`Q8S8P3`	Arabidopsis thaliana	sp\|Q8S8P3\|GT14C_ARATH Beta-glucuronosyltransferase GlcAT14C	59.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card